DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRF1 and mtrf1

DIOPT Version :9

Sequence 1:NP_609617.1 Gene:mRF1 / 34720 FlyBaseID:FBgn0032486 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_002938091.2 Gene:mtrf1 / 100486280 XenbaseID:XB-GENE-991014 Length:444 Species:Xenopus tropicalis


Alignment Length:414 Identity:156/414 - (37%)
Similarity:221/414 - (53%) Gaps:69/414 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RLGYLARRWASTDPLSIQN-------EKLQAYLESLRQEYYAVRVNAAGNSKSYARLAQLEGVVS 67
            |||...||      ..:||       |..|.||:||              ||.:.||.::.|..|
 Frog    53 RLGDHPRR------SYLQNTCTLWECEIFQNYLQSL--------------SKEHERLTEMLGQTS 97

  Fly    68 ALEQRR--------VLERHITSAKDMEAEKDEDMREL------MREENEVYV------------- 105
            ..|..|        .|.|.|...:|:: |.::|:|||      .|||.::..             
 Frog    98 VREDDRRSASRRHSELSRLIGLLRDIK-ETEQDVRELELMCADNREEGQMLALALEEKNTLKQNI 161

  Fly   106 -DLLGKQDQALL-QELLTLSDDEEYPALIFGLNAG--AGGQEAMLFAQELYEMYTGYFEHMGWEW 166
             .|.||..|||| .|...::|      .:..:.:|  .||.....|.:|:::||..|..:..|.:
 Frog   162 NKLRGKLLQALLPHEKYDMND------AVLEVTSGRTTGGDICQQFTKEIFDMYQNYAYYKSWSF 220

  Fly   167 EEFASEGTDIGGLRHASLMVSGEDAFRWLRYEAGVHRVQRVPATEKSGRM---HTSTASITVIPR 228
            |.......:.|||.||:..:|||..::.|:||.|.|||||:|....|.||   ||.|.::.|:|:
 Frog   221 EILNYSPAEYGGLHHAAARISGEGVYKRLKYEGGTHRVQRIPEVGLSSRMQRIHTGTMTVIVLPQ 285

  Fly   229 PADIQVHIAEKDLKIETKRASGAGGQHVNTTDSAVRIVHLPTGLAVEAQSERSQLKNRELAMKRL 293
            |.:::|.|..|||:|:|.|:.||||||||||||||||||:|||:|||.|.||||:.|:|.|::.|
 Frog   286 PDEVEVKIDSKDLRIDTFRSKGAGGQHVNTTDSAVRIVHIPTGIAVECQQERSQIANKEKALRIL 350

  Fly   294 RSRLVQQQLESVEASKMATKKAQQGSLNRNEKIRTYNFVQDRITDHRIQGGTLHNLNGFLKGGDQ 358
            |.||.:|.:|.....:.:.:|.|.|:..::|:||||||.|||:|||||. ..:.|:..||.|.:.
 Frog   351 RMRLYEQTVEQELLERRSARKLQVGTRAQSERIRTYNFTQDRLTDHRIH-YEVRNIKEFLNGEEL 414

  Fly   359 LSGLIEKLQLEHRRERLKELLDRW 382
            |..||:|||.....|.:.||::.:
 Frog   415 LDDLIQKLQESADTEAILELIENY 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRF1NP_609617.1 prfA 35..378 CDD:234801 144/376 (38%)
PCRF 58..222 CDD:281461 61/197 (31%)
RF-1 234..338 CDD:278876 59/103 (57%)
mtrf1XP_002938091.2 prfA 79..434 CDD:234801 144/376 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1313171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.