| Sequence 1: | NP_609616.1 | Gene: | CG9426 / 34719 | FlyBaseID: | FBgn0032485 | Length: | 627 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_173379.1 | Gene: | AT1G19470 / 838531 | AraportID: | AT1G19470 | Length: | 412 | Species: | Arabidopsis thaliana |
| Alignment Length: | 236 | Identity: | 51/236 - (21%) |
|---|---|---|---|
| Similarity: | 80/236 - (33%) | Gaps: | 72/236 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 313 GQLVPLR-VCPRQLAKKNIYIIGGSHRDTPRTWNSADCIFETVAKFDIFRREWTETAPMEVGRIL 376
Fly 377 PGVSALNGKIYVVGGERGSQILANG-EVYDPQNDVWQPIAPMIVPRCEFG------------LCT 428
Fly 429 MGGNLFAV------GGW------------------IGDD----------IGGSMECYDPEQDLWK 459
Fly 460 -----LMGSMPQPRFSMG-VVSFEGLI--------YIVGGC 486 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9426 | NP_609616.1 | BTB | 73..179 | CDD:279045 | |
| PHA03098 | 78..558 | CDD:222983 | 51/236 (22%) | ||
| BACK | 187..289 | CDD:285009 | |||
| Kelch | 330..384 | CDD:128874 | 10/53 (19%) | ||
| KELCH repeat | 374..417 | CDD:276965 | 14/43 (33%) | ||
| Kelch | 385..431 | CDD:128874 | 17/58 (29%) | ||
| KELCH repeat | 421..465 | CDD:276965 | 14/94 (15%) | ||
| Kelch | <447..478 | CDD:128874 | 8/36 (22%) | ||
| Kelch_6 | 467..516 | CDD:290672 | 7/29 (24%) | ||
| KELCH repeat | 468..512 | CDD:276965 | 7/28 (25%) | ||
| Kelch_1 | 515..557 | CDD:279660 | |||
| KELCH repeat | 516..561 | CDD:276965 | |||
| KELCH repeat | 564..617 | CDD:276965 | |||
| Kelch | 575..627 | CDD:128874 | |||
| AT1G19470 | NP_173379.1 | mutarot_permut | 123..>362 | CDD:274642 | 49/232 (21%) |
| PHA03098 | <147..260 | CDD:222983 | 29/122 (24%) | ||
| KELCH repeat | 147..188 | CDD:276965 | 8/49 (16%) | ||
| KELCH repeat | 192..236 | CDD:276965 | 15/44 (34%) | ||
| Kelch_1 | 192..234 | CDD:366584 | 14/42 (33%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X9 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||