| Sequence 1: | NP_609616.1 | Gene: | CG9426 / 34719 | FlyBaseID: | FBgn0032485 | Length: | 627 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_199938.1 | Gene: | AT5G51250 / 835199 | AraportID: | AT5G51250 | Length: | 368 | Species: | Arabidopsis thaliana |
| Alignment Length: | 195 | Identity: | 41/195 - (21%) |
|---|---|---|---|
| Similarity: | 61/195 - (31%) | Gaps: | 69/195 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 329 NIYIIGGSHRDTPRTWNSADCIFETVAKFDIFRREWTETAPMEVGRILPGVSALNGKIYVVGGER 393
Fly 394 GSQILANG-----EVYDPQNDVWQP---------------------------------------- 413
Fly 414 ---IAPMIVPRCEFGLCTMGGNLFAVGGWIGDDIGGSMECYDPEQDLWK----LMG--SMPQPRF 469
Fly 470 469 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9426 | NP_609616.1 | BTB | 73..179 | CDD:279045 | |
| PHA03098 | 78..558 | CDD:222983 | 41/195 (21%) | ||
| BACK | 187..289 | CDD:285009 | |||
| Kelch | 330..384 | CDD:128874 | 14/53 (26%) | ||
| KELCH repeat | 374..417 | CDD:276965 | 15/90 (17%) | ||
| Kelch | 385..431 | CDD:128874 | 16/93 (17%) | ||
| KELCH repeat | 421..465 | CDD:276965 | 11/49 (22%) | ||
| Kelch | <447..478 | CDD:128874 | 8/29 (28%) | ||
| Kelch_6 | 467..516 | CDD:290672 | 1/3 (33%) | ||
| KELCH repeat | 468..512 | CDD:276965 | 1/2 (50%) | ||
| Kelch_1 | 515..557 | CDD:279660 | |||
| KELCH repeat | 516..561 | CDD:276965 | |||
| KELCH repeat | 564..617 | CDD:276965 | |||
| Kelch | 575..627 | CDD:128874 | |||
| AT5G51250 | NP_199938.1 | F-box | 1..46 | CDD:279040 | |
| KELCH repeat | 109..149 | CDD:276965 | 11/40 (28%) | ||
| Kelch_2 | 153..201 | CDD:284956 | 14/47 (30%) | ||
| KELCH repeat | 153..199 | CDD:276965 | 14/45 (31%) | ||
| KELCH repeat | 202..244 | CDD:276965 | 1/41 (2%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X9 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||