DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9426 and AT5G48980

DIOPT Version :9

Sequence 1:	NP_609616.1	Gene:	CG9426 / 34719	FlyBaseID:	FBgn0032485	Length:	627	Species:	Drosophila melanogaster
Sequence 2:	NP_199709.1	Gene:	AT5G48980 / 834957	AraportID:	AT5G48980	Length:	399	Species:	Arabidopsis thaliana

Alignment Length:	124	Identity:	29/124 - (23%)
Similarity:	50/124 - (40%)	Gaps:	38/124 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly   496 LISFNPVTKEWNELARMQTARCQMGVAVLDRYLYVVGGSSISQDI----LSSVERYSFDEDKWTT 556
            :::.:||  ||:            .:..:|.|||     :||.||    .|:|.........|.
plant   138 ILNSHPV--EWS------------AIISVDHYLY-----AISADIEKAPYSNVPYLDCRTHTWN- 182

  Fly   557 VCALNVPRAIPAVVAA--DGLLYVAGGDQPCEVNFYRAQVTINAVECYDPLSDTWKNCP 613
                ..||...|...:  :|::|:.|.        :.:..::|.||.|:.::.|||..|
plant   183 ----EAPRMRLAHTNSEFEGIVYLPGS--------FESPDSLNCVEVYNTMTQTWKPVP 229

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9426	NP_609616.1	BTB	73..179	CDD:279045
		PHA03098	78..558	CDD:222983	15/65 (23%)
		BACK	187..289	CDD:285009
		Kelch	330..384	CDD:128874
		KELCH repeat	374..417	CDD:276965
		Kelch	385..431	CDD:128874
		KELCH repeat	421..465	CDD:276965
		Kelch	<447..478	CDD:128874
		Kelch_6	467..516	CDD:290672	4/19 (21%)
		KELCH repeat	468..512	CDD:276965	4/15 (27%)
		Kelch_1	515..557	CDD:279660	11/45 (24%)
		KELCH repeat	516..561	CDD:276965	11/48 (23%)
		KELCH repeat	564..617	CDD:276965	13/52 (25%)
		Kelch	575..627	CDD:128874	10/39 (26%)
AT5G48980	NP_199709.1	F-box	34..75	CDD:279040
		KELCH repeat	148..187	CDD:276965	12/48 (25%)
		Kelch_1	187..230	CDD:279660	12/51 (24%)
		KELCH repeat	188..230	CDD:276965	12/50 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	1	1.000	-	-		X9
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.910