DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9426 and AT5G39560

DIOPT Version :9

Sequence 1:NP_609616.1 Gene:CG9426 / 34719 FlyBaseID:FBgn0032485 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_198772.2 Gene:AT5G39560 / 833952 AraportID:AT5G39560 Length:403 Species:Arabidopsis thaliana


Alignment Length:249 Identity:52/249 - (20%)
Similarity:84/249 - (33%) Gaps:94/249 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 ALNGKIYVVGG--ERGSQILANGEVYDPQNDVWQPIAPMIVPRCEFGLCTMGGNLFAVGGWIGDD 443
            |:..:|||:||  .|.|.:    .::|.:::.|:....|.|.|.:.....:...::.:||...|:
plant   134 AVGSEIYVIGGHFNRSSSV----RIFDCRSNTWRDGPNMTVARSDPVAVLIDQRIYVLGGREMDE 194

  Fly   444 IGGSMECYDPEQDLWKLMGSMPQPRFSMGVVSFEGLIYIVGGCTTTTRHLPDLISFNPVTKEWNE 508
            .....|.:|.:...|:.:     |.|..|:   |...|||                      |. 
plant   195 SDDWFEVFDIKTQTWRAL-----PSFRAGL---ELRRYIV----------------------WP- 228

  Fly   509 LARMQTARCQMGVAVLDRYLYVVGGSSISQDILSSVERYSFDEDKWTTVCALNV-PRAIPAVVAA 572
                            :||...:|                   |..|.|..:|| |.|:      
plant   229 ----------------NRYFPRLG-------------------DSQTAVRLINVNPNAL------ 252

  Fly   573 DGLLYVAGGDQPCEVNFYRAQVTINAVECYDPLSDTWKNCPDLPVSRSEAGAVV 626
            :|.||||     .::|.|          .|:|..||||......:.|.:...|:
plant   253 EGKLYVA-----AQINDY----------TYEPKDDTWKVVSKSSIRRVKVWCVI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9426NP_609616.1 BTB 73..179 CDD:279045
PHA03098 78..558 CDD:222983 32/178 (18%)
BACK 187..289 CDD:285009
Kelch 330..384 CDD:128874 1/2 (50%)
KELCH repeat 374..417 CDD:276965 10/37 (27%)
Kelch 385..431 CDD:128874 12/47 (26%)
KELCH repeat 421..465 CDD:276965 7/43 (16%)
Kelch <447..478 CDD:128874 6/30 (20%)
Kelch_6 467..516 CDD:290672 8/48 (17%)
KELCH repeat 468..512 CDD:276965 7/43 (16%)
Kelch_1 515..557 CDD:279660 5/41 (12%)
KELCH repeat 516..561 CDD:276965 6/44 (14%)
KELCH repeat 564..617 CDD:276965 14/52 (27%)
Kelch 575..627 CDD:128874 14/52 (27%)
AT5G39560NP_198772.2 KELCH repeat 131..168 CDD:276965 10/37 (27%)
Kelch 139..181 CDD:128874 12/45 (27%)
Kelch_1 171..216 CDD:279660 8/49 (16%)
KELCH repeat 172..220 CDD:276965 10/55 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.