DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9426 and AT5G38670

DIOPT Version :9

Sequence 1:NP_609616.1 Gene:CG9426 / 34719 FlyBaseID:FBgn0032485 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_198683.1 Gene:AT5G38670 / 833857 AraportID:AT5G38670 Length:291 Species:Arabidopsis thaliana


Alignment Length:193 Identity:34/193 - (17%)
Similarity:63/193 - (32%) Gaps:59/193 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 WTETAPMEVGRILPGVSALNGKIYVVGGERGSQILANGEVYDPQNDVWQPIAPMIVPRCEFGLCT 428
            |.|...:.|..:......|:.||||.|..:....: ..:|:|.....|.|:              
plant    71 WHEGPRLRVKLMSCTACVLDEKIYVSGRCKDGDSM-TFQVFDTNTQTWDPL-------------- 120

  Fly   429 MGGNLFAVGGWIGDDIGGSMECYDPEQDLWKLMGSMPQPRFSMGVVSFEGLIYIVGGCTTTTRHL 493
                              |:.|.:.:.|            |...:|.|:|.:::|.        .
plant   121 ------------------SVPCSETKHD------------FHYKIVRFDGKLHLVS--------Y 147

  Fly   494 PDLISFNPVTKEWNELARMQTARCQMGVAVLDRYLYV--VGGSSISQDILSSVERYSFDEDKW 554
            ..:.::|.....|:    :.|...:....:.|.|..:  |..:.:..||.:||..|..:|.:|
plant   148 KGVDAYNSKEGRWD----LVTPSIEHNKYLYDCYRNIGNVWYTIVKGDISTSVWWYHSEEREW 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9426NP_609616.1 BTB 73..179 CDD:279045
PHA03098 78..558 CDD:222983 34/193 (18%)
BACK 187..289 CDD:285009
Kelch 330..384 CDD:128874 4/19 (21%)
KELCH repeat 374..417 CDD:276965 10/42 (24%)
Kelch 385..431 CDD:128874 9/45 (20%)
KELCH repeat 421..465 CDD:276965 3/43 (7%)
Kelch <447..478 CDD:128874 6/30 (20%)
Kelch_6 467..516 CDD:290672 8/48 (17%)
KELCH repeat 468..512 CDD:276965 7/43 (16%)
Kelch_1 515..557 CDD:279660 10/42 (24%)
KELCH repeat 516..561 CDD:276965 10/41 (24%)
KELCH repeat 564..617 CDD:276965
Kelch 575..627 CDD:128874
AT5G38670NP_198683.1 F-box 10..53 CDD:279040
Kelch_2 81..123 CDD:284956 11/74 (15%)
KELCH repeat 81..121 CDD:276965 10/72 (14%)
KELCH repeat 124..165 CDD:276965 9/64 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.