| Sequence 1: | NP_609616.1 | Gene: | CG9426 / 34719 | FlyBaseID: | FBgn0032485 | Length: | 627 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_195922.1 | Gene: | AT5G03020 / 831706 | AraportID: | AT5G03020 | Length: | 347 | Species: | Arabidopsis thaliana |
| Alignment Length: | 234 | Identity: | 60/234 - (25%) |
|---|---|---|---|
| Similarity: | 86/234 - (36%) | Gaps: | 78/234 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 330 IYIIGGSHRDTPRTWNSADCIFETVAKFDIFRREWTETAPMEVGRILPGVSALNGKIYVVGGERG 394
Fly 395 S---QILANGEVYDPQNDVWQPI----------------------APMIVPR------------- 421
Fly 422 ---------CE--FGLCTMGGNLFAV------GG-----WIGDDIGGSMECY---DPEQDLWKLM 461
Fly 462 GSMPQP--RFSMGVVSFEGLIYIVGGCTTTTRHLPDLIS 498 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9426 | NP_609616.1 | BTB | 73..179 | CDD:279045 | |
| PHA03098 | 78..558 | CDD:222983 | 60/234 (26%) | ||
| BACK | 187..289 | CDD:285009 | |||
| Kelch | 330..384 | CDD:128874 | 17/53 (32%) | ||
| KELCH repeat | 374..417 | CDD:276965 | 24/67 (36%) | ||
| Kelch | 385..431 | CDD:128874 | 23/94 (24%) | ||
| KELCH repeat | 421..465 | CDD:276965 | 15/81 (19%) | ||
| Kelch | <447..478 | CDD:128874 | 7/35 (20%) | ||
| Kelch_6 | 467..516 | CDD:290672 | 7/34 (21%) | ||
| KELCH repeat | 468..512 | CDD:276965 | 7/31 (23%) | ||
| Kelch_1 | 515..557 | CDD:279660 | |||
| KELCH repeat | 516..561 | CDD:276965 | |||
| KELCH repeat | 564..617 | CDD:276965 | |||
| Kelch | 575..627 | CDD:128874 | |||
| AT5G03020 | NP_195922.1 | KELCH repeat | 110..151 | CDD:276965 | 13/39 (33%) |
| Kelch | 119..165 | CDD:128874 | 17/53 (32%) | ||
| Kelch_1 | 154..198 | CDD:279660 | 21/43 (49%) | ||
| KELCH repeat | 155..198 | CDD:276965 | 21/42 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X9 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||