DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9426 and AT5G02980

DIOPT Version :10

Sequence 1:NP_609616.1 Gene:CG9426 / 34719 FlyBaseID:FBgn0032485 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_195918.1 Gene:AT5G02980 / 831482 AraportID:AT5G02980 Length:335 Species:Arabidopsis thaliana


Alignment Length:156 Identity:41/156 - (26%)
Similarity:54/156 - (34%) Gaps:48/156 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 IYIIGGSHRDTPRTWNSADCIFETVAKFDIF--RREWTETAP-MEVGRILPGVSALNGKIYVVGG 391
            ||||||      ..|.:..      .|..||  |...|...| |...|.......::|||||:||
plant   116 IYIIGG------LVWGNRS------KKASIFDCRSHQTRRLPKMRFPRASAAAHVIDGKIYVIGG 168

  Fly   392 ERGSQILANGEVYDPQNDVW--QPI------APMIVPRCEFGLC------------TMGGNLFAV 436
            ..     ..||||||....|  .|:      ...:..:....:|            ...|.|:  
plant   169 GE-----IRGEVYDPTTQTWLTTPVDHTTEECQKVYDKHGVNICFVEIDNLLCQTFVFNGKLY-- 226

  Fly   437 GGW---IGDDIGGSMECYDPEQDLWK 459
              |   .|||.|.: .....||:|::
plant   227 --WRHPRGDDFGWA-RVKGVEQELFR 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9426NP_609616.1 BTB_POZ_KLHL27_IPP 63..189 CDD:349565
PHA03098 78..558 CDD:222983 41/156 (26%)
KELCH repeat 374..417 CDD:276965 16/50 (32%)
KELCH repeat 421..465 CDD:276965 11/54 (20%)
KELCH repeat 468..512 CDD:276965
KELCH repeat 516..561 CDD:276965
KELCH repeat 564..617 CDD:276965
Kelch 575..627 CDD:128874
AT5G02980NP_195918.1 F-box_AtAFR-like 14..57 CDD:438923
NanM 81..>190 CDD:442289 30/90 (33%)
KELCH repeat 99..148 CDD:276965 13/43 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.