DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9426 and AT4G39760

DIOPT Version :9

Sequence 1:NP_609616.1 Gene:CG9426 / 34719 FlyBaseID:FBgn0032485 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_195686.1 Gene:AT4G39760 / 830134 AraportID:AT4G39760 Length:369 Species:Arabidopsis thaliana


Alignment Length:242 Identity:50/242 - (20%)
Similarity:88/242 - (36%) Gaps:63/242 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 LVPLR-------VCPRQLAKKNIYIIGGSHRD--TPRTWNSADCIFETVAKFDIFRREWTETAPM 370
            ||||.       :.|..:.....||:|| :.|  :...|...:....|::|          :..|
plant   110 LVPLPCSYNYQVLVPSVIVGSETYIVGG-YDDALSSSVWFYKNGKIHTLSK----------SPSM 163

  Fly   371 EVGRILPGVSALNGKIYVVGGERGSQILANGEVYDPQNDVWQPI---APMIVPRCEFGLCTMGGN 432
            .|.||...|......|||:||....:.:..|||::.:...|:|:   .|.:..:....:.....|
plant   164 SVARIDAVVVGQYPNIYVMGGCDSDESMNWGEVFNIKTQTWEPLPDPGPEVRGQLVRKMKMQKKN 228

  Fly   433 LFAVGGWIGDDIGGSME----CYDPEQDLWKLMGSMPQPRFSMGVVSFEGLIYIVGGCTTTTRHL 493
            ::.           |.|    .||.|:..||:..::  ..||..|:.....||....|..     
plant   229 VYV-----------SSEKKDYIYDTEERTWKVTEAV--FNFSWCVIEKVRYIYYNKNCWW----- 275

  Fly   494 PDLISFNPVTKEWNELARM-------QTARCQMG------VAVLDRY 527
                 .:..:|:|.::..:       :|.|.::.      |.:.||:
plant   276 -----LDTKSKDWRKIKGLDFLNKFRETDRIEIVNLDGKLVMIWDRF 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9426NP_609616.1 BTB 73..179 CDD:279045
PHA03098 78..558 CDD:222983 50/242 (21%)
BACK 187..289 CDD:285009
Kelch 330..384 CDD:128874 13/55 (24%)
KELCH repeat 374..417 CDD:276965 13/45 (29%)
Kelch 385..431 CDD:128874 11/48 (23%)
KELCH repeat 421..465 CDD:276965 8/47 (17%)
Kelch <447..478 CDD:128874 10/34 (29%)
Kelch_6 467..516 CDD:290672 9/55 (16%)
KELCH repeat 468..512 CDD:276965 8/43 (19%)
Kelch_1 515..557 CDD:279660 4/19 (21%)
KELCH repeat 516..561 CDD:276965 4/18 (22%)
KELCH repeat 564..617 CDD:276965
Kelch 575..627 CDD:128874
AT4G39760NP_195686.1 F-box 16..62 CDD:279040
KELCH repeat 167..212 CDD:276965 13/44 (30%)
Kelch_1 170..211 CDD:279660 11/40 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.