DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9426 and AT4G39580

DIOPT Version :9

Sequence 1:	NP_609616.1	Gene:	CG9426 / 34719	FlyBaseID:	FBgn0032485	Length:	627	Species:	Drosophila melanogaster
Sequence 2:	NP_195668.1	Gene:	AT4G39580 / 830112	AraportID:	AT4G39580	Length:	375	Species:	Arabidopsis thaliana

Alignment Length:	139	Identity:	43/139 - (30%)
Similarity:	58/139 - (41%)	Gaps:	23/139 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   329 NIYIIGGSHRDTPRTWNSADCIFETVAKFDIFRREWTETAPMEVGRILPGVSALNGKIYVVGGER 393
            |||.|||...|.|.:         :|:..|....:|.|...|.|.|..|..:.|:|||||.||..
plant   132 NIYAIGGPINDAPSS---------SVSVLDCQCEKWREAPSMRVARNYPTATVLDGKIYVAGGCE 187

  Fly   394 GSQILANGEVYDPQNDVWQPIAPMIVPRCEFGLCTMGG-----NLFAVGGWIGDDIGGSMECYDP 453
            ....|...||:||:...|..:|.....|||..:....|     :||...|.:         .|||
plant   188 DCTSLDCIEVFDPKTQTWDSVASPGTERCERLVYKSVGIEGKYHLFGGAGHV---------AYDP 243

  Fly   454 EQDLWKLMG 462
            ::..|..:|
plant   244 KEGRWDSVG 252

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9426	NP_609616.1	BTB	73..179	CDD:279045
		PHA03098	78..558	CDD:222983	43/139 (31%)
		BACK	187..289	CDD:285009
		Kelch	330..384	CDD:128874	16/53 (30%)
		KELCH repeat	374..417	CDD:276965	17/42 (40%)
		Kelch	385..431	CDD:128874	16/45 (36%)
		KELCH repeat	421..465	CDD:276965	12/47 (26%)
		Kelch	<447..478	CDD:128874	5/16 (31%)
		Kelch_6	467..516	CDD:290672
		KELCH repeat	468..512	CDD:276965
		Kelch_1	515..557	CDD:279660
		KELCH repeat	516..561	CDD:276965
		KELCH repeat	564..617	CDD:276965
		Kelch	575..627	CDD:128874
AT4G39580	NP_195668.1	F-box	26..65	CDD:395521
		PHA03098	<125..300	CDD:222983	43/139 (31%)
		KELCH repeat	125..164	CDD:276965	12/40 (30%)
		KELCH repeat	168..212	CDD:276965	17/43 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	1	1.000	-	-		X9
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	2.910