Sequence 1: | NP_609616.1 | Gene: | CG9426 / 34719 | FlyBaseID: | FBgn0032485 | Length: | 627 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_195667.1 | Gene: | AT4G39570 / 830111 | AraportID: | AT4G39570 | Length: | 395 | Species: | Arabidopsis thaliana |
Alignment Length: | 221 | Identity: | 53/221 - (23%) |
---|---|---|---|
Similarity: | 81/221 - (36%) | Gaps: | 53/221 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 285 DKALKDDCRDMSVKIALRSICRDIASKRGQLVPLRVCPRQL--------AKKNIYIIGGSHRDTP 341
Fly 342 RTWNSA--DCIFETVAKFDIFRREWTETAPMEVGRILPGVSALNGKIYVVGGERG--SQILANGE 402
Fly 403 VYDPQNDVW--QPIAPMIVPRCEFGLCTMGGNLFAVGGWIGDDIGGSMECYDPEQDLWKLMGSMP 465
Fly 466 QPRFSMGVVSF-------EGLIYIVG 484 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9426 | NP_609616.1 | BTB | 73..179 | CDD:279045 | |
PHA03098 | 78..558 | CDD:222983 | 53/221 (24%) | ||
BACK | 187..289 | CDD:285009 | 1/3 (33%) | ||
Kelch | 330..384 | CDD:128874 | 12/55 (22%) | ||
KELCH repeat | 374..417 | CDD:276965 | 18/46 (39%) | ||
Kelch | 385..431 | CDD:128874 | 16/49 (33%) | ||
KELCH repeat | 421..465 | CDD:276965 | 10/43 (23%) | ||
Kelch | <447..478 | CDD:128874 | 8/37 (22%) | ||
Kelch_6 | 467..516 | CDD:290672 | 6/25 (24%) | ||
KELCH repeat | 468..512 | CDD:276965 | 6/24 (25%) | ||
Kelch_1 | 515..557 | CDD:279660 | |||
KELCH repeat | 516..561 | CDD:276965 | |||
KELCH repeat | 564..617 | CDD:276965 | |||
Kelch | 575..627 | CDD:128874 | |||
AT4G39570 | NP_195667.1 | F-box | 31..77 | CDD:279040 | |
KELCH repeat | 145..183 | CDD:276965 | 9/47 (19%) | ||
Kelch | 151..197 | CDD:128874 | 12/55 (22%) | ||
KELCH repeat | 187..232 | CDD:276965 | 18/49 (37%) | ||
Kelch_1 | 187..226 | CDD:279660 | 15/38 (39%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X9 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |