DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9426 and AT4G39570

DIOPT Version :9

Sequence 1:NP_609616.1 Gene:CG9426 / 34719 FlyBaseID:FBgn0032485 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_195667.1 Gene:AT4G39570 / 830111 AraportID:AT4G39570 Length:395 Species:Arabidopsis thaliana


Alignment Length:221 Identity:53/221 - (23%)
Similarity:81/221 - (36%) Gaps:53/221 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 DKALKDDCRDMSVKIALRSICRDIASKRGQLVPLRVCPRQL--------AKKNIYIIGGSHRDTP 341
            |:.||:..:....|:          |....|:|:.|....|        ...:||..||...:..
plant   108 DRTLKNGKKKKKKKM----------SSGNLLIPIPVPNPPLEHWSGHASVGSDIYFFGGYMEENV 162

  Fly   342 RTWNSA--DCIFETVAKFDIFRREWTETAPMEVGRILPGVSALNGKIYVVGGERG--SQILANGE 402
            |:....  ||...|:          .|...:::.|..|..|.::|||||.||..|  :..|...|
plant   163 RSSRVVILDCRSHTL----------REAPSLQMERSDPAASVIDGKIYVAGGVDGDDADSLYPIE 217

  Fly   403 VYDPQNDVW--QPIAPMIVPRCEFGLCTMGGNLFAVGGWIGDDIGGSMECYDPEQDLWKLMGSMP 465
            |:|.:..:|  :||     |..|.....:..:.: |.|.....||..:..||.|:..|...|   
plant   218 VFDIKTQIWDHRPI-----PYWEKDWGALSRSAY-VDGKFYLTIGMKVMAYDLEESRWDFAG--- 273

  Fly   466 QPRFSMGVVSF-------EGLIYIVG 484
               :.||...|       |.::|..|
plant   274 ---YQMGQSWFWSCNCVIENVLYCYG 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9426NP_609616.1 BTB 73..179 CDD:279045
PHA03098 78..558 CDD:222983 53/221 (24%)
BACK 187..289 CDD:285009 1/3 (33%)
Kelch 330..384 CDD:128874 12/55 (22%)
KELCH repeat 374..417 CDD:276965 18/46 (39%)
Kelch 385..431 CDD:128874 16/49 (33%)
KELCH repeat 421..465 CDD:276965 10/43 (23%)
Kelch <447..478 CDD:128874 8/37 (22%)
Kelch_6 467..516 CDD:290672 6/25 (24%)
KELCH repeat 468..512 CDD:276965 6/24 (25%)
Kelch_1 515..557 CDD:279660
KELCH repeat 516..561 CDD:276965
KELCH repeat 564..617 CDD:276965
Kelch 575..627 CDD:128874
AT4G39570NP_195667.1 F-box 31..77 CDD:279040
KELCH repeat 145..183 CDD:276965 9/47 (19%)
Kelch 151..197 CDD:128874 12/55 (22%)
KELCH repeat 187..232 CDD:276965 18/49 (37%)
Kelch_1 187..226 CDD:279660 15/38 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.