Sequence 1: | NP_609616.1 | Gene: | CG9426 / 34719 | FlyBaseID: | FBgn0032485 | Length: | 627 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_849411.1 | Gene: | AT4G19865 / 827732 | AraportID: | AT4G19865 | Length: | 393 | Species: | Arabidopsis thaliana |
Alignment Length: | 243 | Identity: | 52/243 - (21%) |
---|---|---|---|
Similarity: | 78/243 - (32%) | Gaps: | 73/243 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 302 RSICRDIASKR-------GQ-LVPLRVCPRQLAKK-------NIYIIGGSHRDTPRTWNSADCIF 351
Fly 352 ETVAKFDIFRREWTETAPMEVGRILPGVSALNGKIYVVGGERGSQILANGEVYDPQNDVWQPI-- 414
Fly 415 ------------APMIVPRCEFG----LCTMGGNLFAVGGWIGDDIGGSMECY------------ 451
Fly 452 ------DPEQDLWKLMGSMPQPRFSMGVVSFEGLIYIVGGCTTTTRHL 493 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9426 | NP_609616.1 | BTB | 73..179 | CDD:279045 | |
PHA03098 | 78..558 | CDD:222983 | 52/243 (21%) | ||
BACK | 187..289 | CDD:285009 | |||
Kelch | 330..384 | CDD:128874 | 12/53 (23%) | ||
KELCH repeat | 374..417 | CDD:276965 | 12/56 (21%) | ||
Kelch | 385..431 | CDD:128874 | 15/63 (24%) | ||
KELCH repeat | 421..465 | CDD:276965 | 11/65 (17%) | ||
Kelch | <447..478 | CDD:128874 | 8/48 (17%) | ||
Kelch_6 | 467..516 | CDD:290672 | 6/27 (22%) | ||
KELCH repeat | 468..512 | CDD:276965 | 6/26 (23%) | ||
Kelch_1 | 515..557 | CDD:279660 | |||
KELCH repeat | 516..561 | CDD:276965 | |||
KELCH repeat | 564..617 | CDD:276965 | |||
Kelch | 575..627 | CDD:128874 | |||
AT4G19865 | NP_849411.1 | F-box | 35..75 | CDD:279040 | |
KELCH repeat | 141..176 | CDD:276965 | 9/47 (19%) | ||
Kelch | 149..190 | CDD:128874 | 12/53 (23%) | ||
KELCH repeat | 180..231 | CDD:276965 | 12/50 (24%) | ||
Kelch_1 | 185..224 | CDD:279660 | 11/38 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X9 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |