DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9426 and AT3G06570

DIOPT Version :10

Sequence 1:NP_609616.1 Gene:CG9426 / 34719 FlyBaseID:FBgn0032485 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_566286.1 Gene:AT3G06570 / 819836 AraportID:AT3G06570 Length:390 Species:Arabidopsis thaliana


Alignment Length:171 Identity:43/171 - (25%)
Similarity:61/171 - (35%) Gaps:42/171 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 NIYIIGGSHRDTPRTWNSADCIFETVAKFDIFRREWTETAPMEVGRILPGVSA--LNGKIYVVG- 390
            :||.|.|||..:            .|:..|.....|.| || .:|..|..|||  |:.||:||| 
plant   140 DIYNIAGSHASS------------NVSILDCRSNTWRE-AP-RLGVELTSVSASVLDRKIFVVGM 190

  Fly   391 ------GERGSQILANGEVYDPQNDVWQPIAPMIVPRC-----EFGLCTMG--GNLFAVGGWIGD 442
                  .|..:...   ||.|.:...|.| .|.   .|     :|..|...  ...|.|..||..
plant   191 YADDEESESKNDFF---EVLDTETHTWDP-QPF---NCSETKDKFLNCRTAFIDGKFLVKPWIHR 248

  Fly   443 DIGGSMECYDPEQDLWK-LMGSMPQPRFSMGVVSFEGLIYI 482
            .:    ..|:.::..|: :...|....|:........:||:
plant   249 GV----VAYNSKESRWEPVQTKMAMSMFNDSYCQIHNVIYL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9426NP_609616.1 BTB_POZ_KLHL27_IPP 63..189 CDD:349565
PHA03098 78..558 CDD:222983 43/171 (25%)
KELCH repeat 374..417 CDD:276965 16/51 (31%)
KELCH repeat 421..465 CDD:276965 9/51 (18%)
KELCH repeat 468..512 CDD:276965 3/15 (20%)
KELCH repeat 516..561 CDD:276965
KELCH repeat 564..617 CDD:276965
Kelch 575..627 CDD:128874
AT3G06570NP_566286.1 F-box_AtAFR-like 29..69 CDD:438923
NanM 117..>214 CDD:442289 27/90 (30%)
PHA03098 <126..313 CDD:222983 43/171 (25%)
KELCH repeat 130..169 CDD:276965 12/42 (29%)
KELCH repeat 173..218 CDD:276965 16/48 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.