DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9426 and AT2G29860

DIOPT Version :9

Sequence 1:NP_609616.1 Gene:CG9426 / 34719 FlyBaseID:FBgn0032485 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_180547.1 Gene:AT2G29860 / 817536 AraportID:AT2G29860 Length:240 Species:Arabidopsis thaliana


Alignment Length:226 Identity:50/226 - (22%)
Similarity:77/226 - (34%) Gaps:63/226 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 VVGGERGSQILANGEVYDPQNDVWQPIAPMIVPRCEFGLCTM----------GGNLFAVGGWIGD 442
            :.||..|.....|.:.. |:..:...:||  :|||.:...::          ...||.....:|.
plant     7 IPGGSNGDDPNMNPQEL-PEELIESIVAP--IPRCYYPSLSLLSRAFRHVITSQQLFVTRSGLGF 68

  Fly   443 D-------IGGSMECYDPEQDLW------------KLMGSMPQPRFSMGVVSFEGLIYIVGGCTT 488
            .       ||    |.......|            :.:.|:|.......||:....||::||   
plant    69 KEPVLYAFIG----CTPYTTPRWFILRRSNIPLQLRRLNSLPHMFPGAAVVTIGYKIYVMGG--- 126

  Fly   489 TTRHLPDLISFNPVT---------KEWNELARMQTARCQMGVAVLDRYLYVVGGSSISQDILSSV 544
                    .::.||:         ..|:.|..||.||......|:|..:||:||.. .|| ...|
plant   127 --------YNYQPVSTVIIIDCRFHTWHYLQDMQRARYHATPGVIDGRIYVIGGRK-KQD-ADWV 181

  Fly   545 ERYSFDEDKWTTVCALNVPRAIPAVVAADGL 575
            |.:....:.|.|     ||...|...:.:||
plant   182 EVFDVTTESWET-----VPTQCPNEASENGL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9426NP_609616.1 BTB 73..179 CDD:279045
PHA03098 78..558 CDD:222983 45/207 (22%)
BACK 187..289 CDD:285009
Kelch 330..384 CDD:128874
KELCH repeat 374..417 CDD:276965 6/28 (21%)
Kelch 385..431 CDD:128874 10/52 (19%)
KELCH repeat 421..465 CDD:276965 10/72 (14%)
Kelch <447..478 CDD:128874 6/42 (14%)
Kelch_6 467..516 CDD:290672 12/57 (21%)
KELCH repeat 468..512 CDD:276965 10/52 (19%)
Kelch_1 515..557 CDD:279660 13/41 (32%)
KELCH repeat 516..561 CDD:276965 13/44 (30%)
KELCH repeat 564..617 CDD:276965 3/12 (25%)
Kelch 575..627 CDD:128874 1/1 (100%)
AT2G29860NP_180547.1 F-box 22..64 CDD:279040 8/44 (18%)
Kelch_1 108..152 CDD:279660 10/54 (19%)
KELCH repeat 111..151 CDD:276965 10/50 (20%)
Kelch_1 154..196 CDD:279660 15/48 (31%)
KELCH repeat 155..195 CDD:276965 13/46 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.