DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9426 and AT2G29800

DIOPT Version :9

Sequence 1:NP_609616.1 Gene:CG9426 / 34719 FlyBaseID:FBgn0032485 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_180541.1 Gene:AT2G29800 / 817530 AraportID:AT2G29800 Length:414 Species:Arabidopsis thaliana


Alignment Length:226 Identity:54/226 - (23%)
Similarity:88/226 - (38%) Gaps:65/226 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 KVIDKALKDDCRDMSVKIALRSICRDIASKRGQLVPLRVCPRQLAKKNIYIIGGSHRDTPRTWNS 346
            |.|...|:.|||..:.: .||::.||..|....::..|          ||::.|..|        
plant   176 KTISTVLEIDCRFNTCR-HLRNMKRDRCSAVAGVIDGR----------IYVVAGRQR-------- 221

  Fly   347 ADCIFETVAKFDIFRREWTETAPMEVGR--ILPGVSA--------------LNGKIYVVGGERGS 395
                     :||    :|.|...:|..|  ::||..:              |:.|||::.|:...
plant   222 ---------RFD----DWVEVFDVETERWELVPGPFSSFASSSGKFIVHVVLDNKIYIMDGDYCF 273

  Fly   396 QILANGEVYDPQNDVWQPIAPMIVPRCEFGL--CTMGGNLFAVGGWIGDDI-GGSMECYDPEQDL 457
                   .|||:...|:...|....|..:.|  |.:...|:|:   :..:| |.|:..|||....
plant   274 -------AYDPRRRRWETWGPESAQRSYWHLSSCVVDDLLYAI---VPREIFGASIVVYDPRGIA 328

  Fly   458 WK-LMGSMPQPR---FSMGVVSFEGLIYIVG 484
            |: :||....|.   |...:.:|.|.:.|:|
plant   329 WRPVMGLEFWPNLVYFESKMANFGGKLVILG 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9426NP_609616.1 BTB 73..179 CDD:279045
PHA03098 78..558 CDD:222983 54/226 (24%)
BACK 187..289 CDD:285009 2/6 (33%)
Kelch 330..384 CDD:128874 13/69 (19%)
KELCH repeat 374..417 CDD:276965 12/58 (21%)
Kelch 385..431 CDD:128874 12/47 (26%)
KELCH repeat 421..465 CDD:276965 14/47 (30%)
Kelch <447..478 CDD:128874 10/34 (29%)
Kelch_6 467..516 CDD:290672 6/21 (29%)
KELCH repeat 468..512 CDD:276965 5/20 (25%)
Kelch_1 515..557 CDD:279660
KELCH repeat 516..561 CDD:276965
KELCH repeat 564..617 CDD:276965
Kelch 575..627 CDD:128874
AT2G29800NP_180541.1 Kelch_1 151..198 CDD:279660 8/22 (36%)
KELCH repeat 154..197 CDD:276965 8/21 (38%)
Kelch_1 201..241 CDD:279660 12/70 (17%)
KELCH repeat 201..241 CDD:276965 12/70 (17%)
KELCH repeat 244..287 CDD:276965 9/49 (18%)
KELCH repeat 292..332 CDD:276965 12/42 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.