| Sequence 1: | NP_609616.1 | Gene: | CG9426 / 34719 | FlyBaseID: | FBgn0032485 | Length: | 627 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_180520.1 | Gene: | AT2G29600 / 817509 | AraportID: | AT2G29600 | Length: | 415 | Species: | Arabidopsis thaliana |
| Alignment Length: | 211 | Identity: | 51/211 - (24%) |
|---|---|---|---|
| Similarity: | 74/211 - (35%) | Gaps: | 58/211 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 460 LMGSMPQPRF-SMGVVSFEGLIYIVGGCTTTTRHLPDLISFNPVTKEWNELARMQTARCQMGVAV 523
Fly 524 LDRYLYVVGGSSISQDILSSVERYSFDEDKWTTVCALNVPRAI--------PAVV--AADGLLYV 578
Fly 579 AGGDQP----------------------------CEV-NFYRAQVT----INAVECYDPLSDTWK 610
Fly 611 ------NCPDLPVSRS 620 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9426 | NP_609616.1 | BTB | 73..179 | CDD:279045 | |
| PHA03098 | 78..558 | CDD:222983 | 30/98 (31%) | ||
| BACK | 187..289 | CDD:285009 | |||
| Kelch | 330..384 | CDD:128874 | |||
| KELCH repeat | 374..417 | CDD:276965 | |||
| Kelch | 385..431 | CDD:128874 | |||
| KELCH repeat | 421..465 | CDD:276965 | 2/4 (50%) | ||
| Kelch | <447..478 | CDD:128874 | 6/18 (33%) | ||
| Kelch_6 | 467..516 | CDD:290672 | 12/49 (24%) | ||
| KELCH repeat | 468..512 | CDD:276965 | 9/44 (20%) | ||
| Kelch_1 | 515..557 | CDD:279660 | 15/41 (37%) | ||
| KELCH repeat | 516..561 | CDD:276965 | 14/44 (32%) | ||
| KELCH repeat | 564..617 | CDD:276965 | 16/101 (16%) | ||
| Kelch | 575..627 | CDD:128874 | 15/85 (18%) | ||
| AT2G29600 | NP_180520.1 | F-box | 60..103 | CDD:279040 | |
| Kelch_1 | 149..195 | CDD:279660 | 9/45 (20%) | ||
| KELCH repeat | 152..194 | CDD:276965 | 8/41 (20%) | ||
| Kelch_1 | 197..239 | CDD:279660 | 17/48 (35%) | ||
| KELCH repeat | 198..241 | CDD:276965 | 17/49 (35%) | ||
| NHL | <207..>295 | CDD:302697 | 19/94 (20%) | ||
| NHL repeat | 247..282 | CDD:271320 | 5/34 (15%) | ||
| KELCH repeat | 289..330 | CDD:276965 | 9/40 (23%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X9 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||