DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9426 and AT2G22050

DIOPT Version :9

Sequence 1:	NP_609616.1	Gene:	CG9426 / 34719	FlyBaseID:	FBgn0032485	Length:	627	Species:	Drosophila melanogaster
Sequence 2:	NP_179796.2	Gene:	AT2G22050 / 816740	AraportID:	AT2G22050	Length:	259	Species:	Arabidopsis thaliana

Alignment Length:	132	Identity:	42/132 - (31%)
Similarity:	59/132 - (44%)	Gaps:	27/132 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   330 IYIIGGSHRDTPRTWNSADCIFETVAKFDIFRREWTETAPMEVGRI-LPGVSALNGKIYVVGG-E 392
            ||.:|||.......|     |.:|  :..:||    :...|:|.|. ...|..:||||||:|| |
plant   143 IYFVGGSFEPMSELW-----ILDT--RTGMFR----QGPSMKVARTDEASVGVINGKIYVIGGCE 196

  Fly   393 RGSQILANGEVYDPQNDVWQPIAPMIVP--RCEFGLCTMGGNLFAVG-GWIGDDIG-GSMECYDP 453
            ...|:    |||||::..|:....   |  :.:.||.|   .|.||. .|....:. |.:..|||
plant   197 DKIQV----EVYDPKSRSWKTTKD---PEEKTQRGLMT---RLSAVSLDWKVYTVEVGRIGVYDP 251

  Fly   454 EQ 455
            .:
plant   252 RE 253

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9426	NP_609616.1	BTB	73..179	CDD:279045
		PHA03098	78..558	CDD:222983	42/132 (32%)
		BACK	187..289	CDD:285009
		Kelch	330..384	CDD:128874	14/54 (26%)
		KELCH repeat	374..417	CDD:276965	18/44 (41%)
		Kelch	385..431	CDD:128874	18/48 (38%)
		KELCH repeat	421..465	CDD:276965	11/37 (30%)
		Kelch	<447..478	CDD:128874	3/9 (33%)
		Kelch_6	467..516	CDD:290672
		KELCH repeat	468..512	CDD:276965
		Kelch_1	515..557	CDD:279660
		KELCH repeat	516..561	CDD:276965
		KELCH repeat	564..617	CDD:276965
		Kelch	575..627	CDD:128874
AT2G22050	NP_179796.2	F-box	29..74	CDD:279040
		KELCH repeat	129..172	CDD:276965	10/39 (26%)
		Kelch	143..187	CDD:128874	14/54 (26%)
		KELCH repeat	176..220	CDD:276965	19/50 (38%)
		Kelch_1	180..212	CDD:279660	16/35 (46%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910