DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9426 and AT2G21680

DIOPT Version :9

Sequence 1:NP_609616.1 Gene:CG9426 / 34719 FlyBaseID:FBgn0032485 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_179761.4 Gene:AT2G21680 / 816706 AraportID:AT2G21680 Length:429 Species:Arabidopsis thaliana


Alignment Length:218 Identity:50/218 - (22%)
Similarity:86/218 - (39%) Gaps:45/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   419 VPRCEFG--LCTMGGNLFAVGGWIG----DDIGGSMECYDPEQDLWKLMG-SMPQPRFSMGVVSF 476
            :|...:|  :.|:|.:::.:||.:|    :|:|               :| :.|......|..| 
plant   129 LPPMPWGSTVVTIGSDIYVIGGRVGEKLLEDVG---------------VGYNKPISGGRRGETS- 177

  Fly   477 EGLIYIVGGCTTTTRHLPDLISFNPVTKEWNELARMQTARCQMGVAVLDRYLYVVGGSSISQDIL 541
                  :.|.....|.:.|:...|....|:..|..|:.|||:....|:|..:||:||..:...  
plant   178 ------IRGGHAGERRISDVTHINCRFHEYRSLPSMKMARCRAAAGVIDGKIYVIGGRKVRTS-- 234

  Fly   542 SSVERYSFDEDKWTTVCALNVPRAIP-AVVAADGLLYVAGGDQPCEVNFYRAQVTINAVECYDPL 605
            ..||.:...:..|:     :||...| |....:.|.|..     .:...|...:|.| :..|||.
plant   235 DWVEVFDLKKQSWS-----SVPGPYPEAFGRGEFLTYAV-----MKEKIYCLDLTRN-IHIYDPK 288

  Fly   606 SDTWKNCPDLPVSRS--EAGAVV 626
            ...|::....|:|.|  ::..||
plant   289 ESKWESWTHGPLSASWNDSSCVV 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9426NP_609616.1 BTB 73..179 CDD:279045
PHA03098 78..558 CDD:222983 32/145 (22%)
BACK 187..289 CDD:285009
Kelch 330..384 CDD:128874
KELCH repeat 374..417 CDD:276965
Kelch 385..431 CDD:128874 3/13 (23%)
KELCH repeat 421..465 CDD:276965 9/50 (18%)
Kelch <447..478 CDD:128874 4/31 (13%)
Kelch_6 467..516 CDD:290672 9/48 (19%)
KELCH repeat 468..512 CDD:276965 8/43 (19%)
Kelch_1 515..557 CDD:279660 12/41 (29%)
KELCH repeat 516..561 CDD:276965 11/44 (25%)
KELCH repeat 564..617 CDD:276965 11/53 (21%)
Kelch 575..627 CDD:128874 14/54 (26%)
AT2G21680NP_179761.4 F-box 42..76 CDD:395521
PHA03098 <85..339 CDD:222983 50/218 (23%)
KELCH repeat 135..207 CDD:276965 18/93 (19%)
Kelch_1 210..251 CDD:396078 12/47 (26%)
KELCH repeat 211..255 CDD:276965 13/50 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.