DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9426 and AT2G20380

DIOPT Version :9

Sequence 1:NP_609616.1 Gene:CG9426 / 34719 FlyBaseID:FBgn0032485 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_179628.1 Gene:AT2G20380 / 816557 AraportID:AT2G20380 Length:348 Species:Arabidopsis thaliana


Alignment Length:163 Identity:35/163 - (21%)
Similarity:67/163 - (41%) Gaps:38/163 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 IAPMI-VPRCEF-GLCTMGGNLFAVGGWIGDDIGGSMEC---YDPEQDLWKLMGSMPQP--RFSM 471
            :||:: .|..|| .|..:|..|:|....|.:....|:.|   |:.:...|     :|.|  :...
plant   107 LAPILNSPPVEFPSLIAVGSYLYAFRAAIEEGTSDSLNCVEVYNTDTQTW-----IPVPPNKRIF 166

  Fly   472 GVVSFEGLIYIVGGCTTTTRHLPDLISFNPVTKEWNELA----RMQTARCQMGVAVLDRYL--YV 530
            .:...:|::|:         .:..|:||  |.::..|||    ::::......||...:..  |.
plant   167 KLQHMKGMLYM---------KVSKLLSF--VAQDAEELAPLFPKLRSLLSTEVVAFKPKVSEGYE 220

  Fly   531 VGGSSISQDI----LSSVERYSFDED-----KW 554
            |.|.|::.|:    ...:|..::..|     :|
plant   221 VLGFSVNTDLGRGSFCMIEEITYHYDPSVKFRW 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9426NP_609616.1 BTB 73..179 CDD:279045
PHA03098 78..558 CDD:222983 35/163 (21%)
BACK 187..289 CDD:285009
Kelch 330..384 CDD:128874
KELCH repeat 374..417 CDD:276965 1/2 (50%)
Kelch 385..431 CDD:128874 6/18 (33%)
KELCH repeat 421..465 CDD:276965 11/47 (23%)
Kelch <447..478 CDD:128874 6/35 (17%)
Kelch_6 467..516 CDD:290672 10/54 (19%)
KELCH repeat 468..512 CDD:276965 9/47 (19%)
Kelch_1 515..557 CDD:279660 10/51 (20%)
KELCH repeat 516..561 CDD:276965 10/50 (20%)
KELCH repeat 564..617 CDD:276965
Kelch 575..627 CDD:128874
AT2G20380NP_179628.1 F-box 19..62 CDD:279040
Kelch_6 118..161 CDD:290672 11/47 (23%)
KELCH repeat 120..161 CDD:276965 10/45 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.