DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9426 and Btbd35f17

DIOPT Version :9

Sequence 1:NP_609616.1 Gene:CG9426 / 34719 FlyBaseID:FBgn0032485 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_001079023.1 Gene:Btbd35f17 / 668964 MGIID:3709272 Length:498 Species:Mus musculus


Alignment Length:215 Identity:50/215 - (23%)
Similarity:87/215 - (40%) Gaps:30/215 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 YPFKVLSNLNQLR--------EQSRF-----CDVEIIAGMATLSAHRAVLSAASAYFEAMFRPEL 116
            ||.:||:.:...|        .|:.|     .|::|.|...|...|:..| ..|.||..:.:   
Mouse    59 YPHQVLNYIYWKRVKISSNDAYQNLFLDGHDSDIKIRALGKTWCLHKVFL-CQSGYFANILK--- 119

  Fly   117 GLNEVKQKSVV-----LHTIDGDILHILLDFIYT-GRCEITQSNVQELLAAADMLQLNEVVDGCC 175
            |........|:     ...||...||.:...:|| ....||...|.::||||.:|:::.|:..|.
Mouse   120 GTWRESHHGVINLIIKNEDIDTRSLHFVFGALYTDADLSITPLEVPQVLAAACLLRVDRVIQQCE 184

  Fly   176 EFLCRELHASNALGILRFAEAHNCESLAKSALNFVHANF---PAVTLEDEFLETPQTLLSQL-LN 236
            ..:...::.:........||.:..:::......::..|.   |:|.|   :.|....|:..| |:
Mouse   185 GIMKETINRNTVCSYYLAAETYRLKAVKTRCFEWLLCNLMVHPSVAL---YKEVDLKLMYLLALS 246

  Fly   237 SELLRVDSESQVFQAALRWI 256
            |:||.:..|..|:.....|:
Mouse   247 SDLLVMQKEIDVYTTLKIWM 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9426NP_609616.1 BTB 73..179 CDD:279045 30/124 (24%)
PHA03098 78..558 CDD:222983 45/194 (23%)
BACK 187..289 CDD:285009 16/74 (22%)
Kelch 330..384 CDD:128874
KELCH repeat 374..417 CDD:276965
Kelch 385..431 CDD:128874
KELCH repeat 421..465 CDD:276965
Kelch <447..478 CDD:128874
Kelch_6 467..516 CDD:290672
KELCH repeat 468..512 CDD:276965
Kelch_1 515..557 CDD:279660
KELCH repeat 516..561 CDD:276965
KELCH repeat 564..617 CDD:276965
Kelch 575..627 CDD:128874
Btbd35f17NP_001079023.1 BTB 80..188 CDD:279045 29/111 (26%)
BTB 91..191 CDD:197585 27/103 (26%)
BACK 196..>266 CDD:197943 15/72 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.