DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9426 and KLHL18

DIOPT Version :9

Sequence 1:NP_609616.1 Gene:CG9426 / 34719 FlyBaseID:FBgn0032485 Length:627 Species:Drosophila melanogaster
Sequence 2:XP_005265058.2 Gene:KLHL18 / 23276 HGNCID:29120 Length:584 Species:Homo sapiens


Alignment Length:605 Identity:198/605 - (32%)
Similarity:289/605 - (47%) Gaps:63/605 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 ASHRTNLPSYCNAQYPFKVLSNLNQLREQSRFCDVEIIAGMATLSAHRAVLSAASAYFEAMFRPE 115
            |....:|..:..::.|.:....:.::|.|.:.|||.:..|....||||.||:|:..||.|||..:
Human     6 AEELEDLVHFSVSELPSRGYGVMEEIRRQGKLCDVTLKIGDHKFSAHRIVLAASIPYFHAMFTND 70

  Fly   116 LGLNEVKQKSVVLHTIDGDILHILLDFIYTGRCEITQSNVQELLAAADMLQLNEVVDGCCEFLCR 180
              :.|.||..:|:..:|...|..|::|.|.|...|.|.|||.||..|..|||..:.|.||.||..
Human    71 --MMECKQDEIVMQGMDPSALEALINFAYNGNLAIDQQNVQSLLMGASFLQLQSIKDACCTFLRE 133

  Fly   181 ELHASNALGILRFAEAHNCESLAKSALNFVHANFPAVTLEDEFLETPQTLLSQLLNSELLRVDSE 245
            .||..|.||:.:|||...|..|..:|.:|:|.:|..|::.:|||..|...:.:|::.:.|.|.||
Human   134 RLHPKNCLGVRQFAETMMCAVLYDAANSFIHQHFVEVSMSEEFLALPLEDVLELVSRDELNVKSE 198

  Fly   246 SQVFQAALRWIKHDVTQRRCYVFDVLSHVRMALV-PVKVIDKALKDD-------CRDMSVKIALR 302
            .|||:|||.|:::|..||..|:.::||::|:.|. |..:.|:..:||       |||      |.
Human   199 EQVFEAALAWVRYDREQRGPYLPELLSNIRLPLCRPQFLSDRVQQDDLVRCCHKCRD------LV 257

  Fly   303 SICRD---IASKRGQLVPLRVCPR---QLAKKNIYIIGGSHRDTPRTWNSADCIF-----ETVAK 356
            ...:|   :..:|..|...|..||   .:|.. ||.:||        .|||...:     ..|..
Human   258 DEAKDYHLMPERRPHLPAFRTRPRCCTSIAGL-IYAVGG--------LNSAANFYAGDSLNVVEV 313

  Fly   357 FDIFRREWTETAPMEVGRILPGVSALNGKIYVVGGERGSQILANGEVYDPQNDVWQPIAPMIVPR 421
            ||.....|....||...|...||:.:||.:|.:||..|...|:..|.|:|:.|.|..:..|...|
Human   314 FDPIANCWERCRPMTTARSRVGVAVVNGLLYAIGGYDGQLRLSTVEAYNPETDTWTRVGSMNSKR 378

  Fly   422 CEFGLCTMG-----GNLFAVGGWIGDDIGGSMECYDPEQDLWKLMGSMPQPRFSMGVVSFEGLIY 481
            .......||     |.::..||:.|:....|:|.|.||.|.|.::.||...|.:.||..|||.||
Human   379 SSVCFSAMGTVVLDGQIYVCGGYDGNSSLSSVETYSPETDKWTVVTSMSSNRSAAGVTVFEGRIY 443

  Fly   482 IVGG-----CTTTTRHLPDLISFNPVTKEWNELARMQTARCQMGVAVLDRYLYVVGGSSISQDIL 541
            :.||     ..::..|      :|..|..|:..|.|...||:.|.|.|...::|.||.. ....|
Human   444 VSGGHDGLQIFSSVEH------YNHHTATWHPAAGMLNKRCRHGAASLGSKMFVCGGYD-GSGFL 501

  Fly   542 SSVERYSFDEDKWTTVCALNVPRAIPAVVAADGLLYVAGGDQPCEVNFYRAQVTINAVECYDPLS 606
            |..|.||...|:|..:..::..|:..::||:.|.||..||        |..|..:::||.|||.:
Human   502 SIAEMYSSVADQWCLIVPMHTRRSRVSLVASCGRLYAVGG--------YDGQSNLSSVEMYDPET 558

  Fly   607 DTWKNCPDLPVSRSEAGAVV 626
            |.|...  .|::..|.|..|
Human   559 DCWTFM--APMACHEGGVGV 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9426NP_609616.1 BTB 73..179 CDD:279045 43/105 (41%)
PHA03098 78..558 CDD:222983 173/508 (34%)
BACK 187..289 CDD:285009 38/102 (37%)
Kelch 330..384 CDD:128874 16/58 (28%)
KELCH repeat 374..417 CDD:276965 15/42 (36%)
Kelch 385..431 CDD:128874 14/50 (28%)
KELCH repeat 421..465 CDD:276965 15/48 (31%)
Kelch <447..478 CDD:128874 13/30 (43%)
Kelch_6 467..516 CDD:290672 16/53 (30%)
KELCH repeat 468..512 CDD:276965 15/48 (31%)
Kelch_1 515..557 CDD:279660 15/41 (37%)
KELCH repeat 516..561 CDD:276965 15/44 (34%)
KELCH repeat 564..617 CDD:276965 17/52 (33%)
Kelch 575..627 CDD:128874 17/52 (33%)
KLHL18XP_005265058.2 BTB 28..131 CDD:279045 42/104 (40%)
PHA03098 34..562 CDD:222983 189/559 (34%)
BACK 140..242 CDD:285009 38/101 (38%)
KELCH repeat 282..327 CDD:276965 12/53 (23%)
Kelch 289..341 CDD:128874 16/60 (27%)
Kelch_1 330..375 CDD:279660 15/44 (34%)
KELCH repeat 331..374 CDD:276965 15/42 (36%)
KELCH repeat 378..427 CDD:276965 15/48 (31%)
Kelch 394..440 CDD:128874 16/45 (36%)
KELCH repeat 430..474 CDD:276965 15/49 (31%)
Kelch 441..486 CDD:128874 14/50 (28%)
KELCH repeat 477..521 CDD:276965 15/44 (34%)
Kelch_1 477..520 CDD:279660 15/43 (35%)
Kelch_1 523..567 CDD:279660 17/53 (32%)
KELCH repeat 524..567 CDD:276965 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4441
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312716at33208
OrthoFinder 1 1.000 - - FOG0000036
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.