DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9426 and gcl-1

DIOPT Version :9

Sequence 1:NP_609616.1 Gene:CG9426 / 34719 FlyBaseID:FBgn0032485 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_502585.1 Gene:gcl-1 / 190457 WormBaseID:WBGene00013382 Length:496 Species:Caenorhabditis elegans


Alignment Length:418 Identity:85/418 - (20%)
Similarity:149/418 - (35%) Gaps:101/418 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 AQYPFKVLSNLN-------QLREQSRFCDVEIIAGMATLSAHRAVLSAASAYFEAMFR---PELG 117
            ::...|.::.||       :|..|....|:.:.|.......|:..|. .:.:||:||.   .|..
 Worm    43 SEIEMKKVAKLNTCAYVYQKLFLQGENSDIVLAACGREWRVHKLYLK-QTKFFESMFDGLWTESN 106

  Fly   118 LNEVKQKSVVLHTIDGDILHILLDFIYTGRCEITQSNVQELLAAADMLQLNEVVDGCCEFLCREL 182
            ...| |..:....||.|.|:.:|..:|....||....::..:|||..:.|:.|.|.|.|.:...|
 Worm   107 SGRV-QMEITDPNIDADGLNSVLGSLYHNEIEIDLDKIEGTVAAASYIVLDSVTDRCSEMMIEAL 170

  Fly   183 HASNALGILRFAEAHNCESLAKSALN-FVHANFPAVTLEDEFLETPQTLLSQLLNS-ELLRVDSE 245
            ...||:.....:..:..|.:.:.::. .:|..:..:|..::..|..:.|...|||| .||.::.|
 Worm   171 STKNAVRFYDVSTKYGLEKVREKSMEVLLHQFWKIMTDREKLNEVDRQLFVTLLNSPNLLIIEGE 235

  Fly   246 SQVFQAALRWI---------KHD----VTQRRCYVF------------DVLSHVRM--------- 276
            ..:::....||         |.|    .||.....|            |:.:.:|:         
 Worm   236 FDLYKVVKSWIYMREVPDCCKDDSPETFTQNASKFFKESKTSMFIKYADIFASLRIEQFLTCSET 300

  Fly   277 -------ALVPVKVIDKALKDDCRDMSVKIALRSICRDIASKRGQLVPLRVCPRQLAK------K 328
                   ||:|:.::|:          :..||.|          .|:.....|:.|..      |
 Worm   301 IKTVKSDALIPLSIVDE----------MTSALWS----------SLLENEESPKTLEMDDDEFFK 345

  Fly   329 NIYIIGGSHRDTPRTWN------SADCIFETVAKFD--IFRREWTETAPMEVGRILPGVSALNGK 385
            ....:|.|....|:.|.      ..|.:.. |..:.  |.|....:.||..|.  |.....|:.:
 Worm   346 RCIRLGRSLDSFPKCWRWIGFNFGVDLLLH-VNDYSVCIKRNCLNQKAPYSVN--LKSKHVLHYR 407

  Fly   386 IYVVGGERGSQILANGEV-YDPQNDVWQ 412
            :.:..        :||:: ||.....|:
 Worm   408 LVICD--------SNGQILYDSGKTTWE 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9426NP_609616.1 BTB 73..179 CDD:279045 31/115 (27%)
PHA03098 78..558 CDD:222983 81/396 (20%)
BACK 187..289 CDD:285009 26/144 (18%)
Kelch 330..384 CDD:128874 13/61 (21%)
KELCH repeat 374..417 CDD:276965 7/40 (18%)
Kelch 385..431 CDD:128874 5/29 (17%)
KELCH repeat 421..465 CDD:276965
Kelch <447..478 CDD:128874
Kelch_6 467..516 CDD:290672
KELCH repeat 468..512 CDD:276965
Kelch_1 515..557 CDD:279660
KELCH repeat 516..561 CDD:276965
KELCH repeat 564..617 CDD:276965
Kelch 575..627 CDD:128874
gcl-1NP_502585.1 BTB_POZ_GCL 55..169 CDD:349614 29/115 (25%)
BACK 170..248 CDD:391941 17/77 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.