Sequence 1: | NP_001260435.1 | Gene: | kek4 / 34718 | FlyBaseID: | FBgn0032484 | Length: | 649 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001135393.1 | Gene: | Lrfn1 / 80749 | MGIID: | 2136810 | Length: | 766 | Species: | Mus musculus |
Alignment Length: | 400 | Identity: | 89/400 - (22%) |
---|---|---|---|
Similarity: | 149/400 - (37%) | Gaps: | 69/400 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 LALIFRSASADWLLDC-GNCHCKWNSGKKTADCRNLSLSGVPEYLSPEVQVLDLSHNHIFYLEEN 90
Fly 91 AFLTTHLQNLQKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSKVRAIFLNG 155
Fly 156 NLLQALRHGVF-RNLKYLHKIELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLRVESFQDLTK 219
Fly 220 LTALSLVE--------------------------------NPWNCTCDLQMFRDFVIGMNLYTPP 252
Fly 253 TSCHYPLQLRGRLWIEDQPEAFACKPKIVYPTL-STSINTSKENVTLICRVHGSPNTVIAWDYTN 316
Fly 317 QVYESRSKPVKSLQKQRIYIELLREDESKIRKFGH-DVFVSRLTIVNARKSDEGVYTCLAENPGG 380
Fly 381 KDSVHISVVV 390 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek4 | NP_001260435.1 | leucine-rich repeat | 75..99 | CDD:275380 | 5/23 (22%) |
LRR_8 | 99..158 | CDD:290566 | 14/58 (24%) | ||
leucine-rich repeat | 100..123 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 124..147 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 146..206 | CDD:290566 | 13/60 (22%) | ||
leucine-rich repeat | 148..171 | CDD:275380 | 5/23 (22%) | ||
leucine-rich repeat | 172..195 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 6/22 (27%) | ||
TPKR_C2 | 228..277 | CDD:301599 | 14/48 (29%) | ||
IG_like | 294..390 | CDD:214653 | 24/96 (25%) | ||
Ig | 296..387 | CDD:143165 | 23/91 (25%) | ||
Lrfn1 | NP_001135393.1 | LRR 1 | 66..87 | 6/22 (27%) | |
leucine-rich repeat | 67..90 | CDD:275380 | 6/24 (25%) | ||
PPP1R42 | 70..226 | CDD:411060 | 34/157 (22%) | ||
LRR 2 | 90..111 | 4/20 (20%) | |||
leucine-rich repeat | 91..114 | CDD:275380 | 5/22 (23%) | ||
LRR 3 | 114..135 | 5/20 (25%) | |||
leucine-rich repeat | 115..138 | CDD:275380 | 6/22 (27%) | ||
LRR 4 | 138..159 | 4/20 (20%) | |||
leucine-rich repeat | 139..163 | CDD:275380 | 5/23 (22%) | ||
LRR 5 | 163..184 | 4/20 (20%) | |||
leucine-rich repeat | 164..187 | CDD:275380 | 4/22 (18%) | ||
LRR 6 | 187..208 | 5/20 (25%) | |||
leucine-rich repeat | 188..211 | CDD:275380 | 6/22 (27%) | ||
LRR 7 | 211..232 | 3/20 (15%) | |||
leucine-rich repeat | 212..230 | CDD:275380 | 2/17 (12%) | ||
LRRCT | 252..>284 | CDD:214507 | 11/35 (31%) | ||
Ig | 299..387 | CDD:416386 | 24/112 (21%) | ||
Ig strand A | 299..302 | CDD:409353 | 0/2 (0%) | ||
Ig strand A' | 306..310 | CDD:409353 | 0/3 (0%) | ||
Ig strand B | 316..324 | CDD:409353 | 4/7 (57%) | ||
Ig strand C | 330..335 | CDD:409353 | 2/14 (14%) | ||
Ig strand C' | 338..340 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 346..350 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 353..357 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 367..374 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 377..387 | CDD:409353 | 2/9 (22%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 397..424 | ||||
FN3 | 426..500 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 568..601 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 645..742 | ||||
PDZ-binding | 763..766 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm43981 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |