DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and LRFN4

DIOPT Version :10

Sequence 1:NP_609615.2 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_076941.2 Gene:LRFN4 / 78999 HGNCID:28456 Length:635 Species:Homo sapiens


Alignment Length:397 Identity:93/397 - (23%)
Similarity:145/397 - (36%) Gaps:67/397 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LALIFRSASADWLLDCGNCHCKWNSGKKTADCRNLSLSGVPEYLSPEVQVLDLSHNHIFYLEENA 91
            |.|:..|.:|...|.   |.|:..|...:..|.:..|..||..:......|.|:.|.|..|....
Human     6 LLLLLASGAAACPLP---CVCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFIQALGPPD 67

  Fly    92 FLTTHLQNLQKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSKVRAIFLNGN 156
            |  .::..|..|.:....:..:..|:|..|:.|..|.|..|.||:|..........::.:.|:||
Human    68 F--RNMTGLVDLTLSRNAITRIGARAFGDLESLRSLHLDGNRLVELGTGSLRGPVNLQHLILSGN 130

  Fly   157 LLQALRHGVFRN-LKYLHKIELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLRVESFQDLTKL 220
            .|..:..|.|.: |:.|..::|..|.|..:.......:|.|..:.||:|.:..|...:|..|.:|
Human   131 QLGRIAPGAFDDFLESLEDLDLSYNNLRQVPWAGIGAMPALHTLNLDHNLIDALPPGAFAQLGQL 195

  Fly   221 TALSLVE-------------------------------NPWNCTCDLQMFRDFVIGMNLYTPPTS 254
            :.|.|..                               ||.:|.|:|...|......:|.|    
Human   196 SRLDLTSNRLATLAPDPLFSRGRDAEASPAPLVLSFSGNPLHCNCELLWLRRLARPDDLET---- 256

  Fly   255 CHYPLQLRGR-LWIEDQPEAFACKPKIVYPTLSTSINTSKENVTLICRVHGSPNTVIAWDYTNQV 318
            |..|..|.|| .|...:.| |:|:|.::............:..||.||..|.|...:.|...:  
Human   257 CASPPGLAGRYFWAVPEGE-FSCEPPLIARHTQRLWVLEGQRATLRCRALGDPAPTMHWVGPD-- 318

  Fly   319 YESRSKPVKSLQKQRIYIELLREDESKIRKFGHDVFVSRLTIVNARKSDEGVYTCLAENPGGKDS 383
                              :.|..:.|:.|.|.:    ..|.|......|.|.|||:|.||.|:.:
Human   319 ------------------DRLVGNSSRARAFPN----GTLEIGVTGAGDAGGYTCIATNPAGEAT 361

  Fly   384 VHISVVV 390
            ..:.:.|
Human   362 ARVELRV 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_609615.2 LRR 59..>228 CDD:443914 43/200 (22%)
leucine-rich repeat 75..99 CDD:275380 6/23 (26%)
LRR_8 98..158 CDD:404697 15/59 (25%)
leucine-rich repeat 100..123 CDD:275380 5/22 (23%)
leucine-rich repeat 124..147 CDD:275380 7/22 (32%)
leucine-rich repeat 148..171 CDD:275380 7/23 (30%)
leucine-rich repeat 172..195 CDD:275380 4/22 (18%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
LRRCT 228..277 CDD:214507 16/49 (33%)
IG_like 294..390 CDD:214653 22/95 (23%)
Ig strand B 296..300 CDD:409353 2/3 (67%)
Ig strand C 309..323 CDD:409353 1/13 (8%)
Ig strand E 356..360 CDD:409353 1/3 (33%)
Ig strand F 370..375 CDD:409353 3/4 (75%)
Ig strand G 383..386 CDD:409353 0/2 (0%)
LRFN4NP_076941.2 LRR 1 49..70 6/22 (27%)
leucine-rich repeat 50..73 CDD:275380 6/24 (25%)
LRR <52..>215 CDD:443914 40/164 (24%)
LRR 2 73..94 4/20 (20%)
leucine-rich repeat 74..97 CDD:275380 5/22 (23%)
LRR 3 97..118 7/20 (35%)
leucine-rich repeat 98..121 CDD:275380 7/22 (32%)
LRR 4 121..142 6/20 (30%)
leucine-rich repeat 122..146 CDD:275380 7/23 (30%)
LRR 5 146..161 4/14 (29%)
leucine-rich repeat 147..170 CDD:275380 4/22 (18%)
LRR 6 170..191 6/20 (30%)
leucine-rich repeat 171..194 CDD:275380 7/22 (32%)
LRR 7 194..215 3/20 (15%)
leucine-rich repeat 195..213 CDD:275380 3/17 (18%)
LRRCT 234..278 CDD:214507 16/48 (33%)
Ig 281..368 CDD:472250 22/110 (20%)
Ig strand B 298..302 CDD:409421 2/3 (67%)
Ig strand C 311..315 CDD:409421 0/3 (0%)
Ig strand E 334..338 CDD:409421 1/3 (33%)
Ig strand F 348..353 CDD:409421 3/4 (75%)
Ig strand G 361..364 CDD:409421 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 373..410
fn3 409..478 CDD:394996
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 555..583
PDZ-binding 632..635
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.