DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and lrrc24

DIOPT Version :9

Sequence 1:NP_001260435.1 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:XP_031759297.1 Gene:lrrc24 / 779773 XenbaseID:XB-GENE-923418 Length:569 Species:Xenopus tropicalis


Alignment Length:449 Identity:104/449 - (23%)
Similarity:190/449 - (42%) Gaps:57/449 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SLFLFKIYCLALIFRSASADWLLDCGNCHCKWNSGKKTADCRNLSLSGVPEYLSPEVQVLDLSHN 82
            |:|||..:.|.::....:.....:| .|:      ..|.:|.:..|..||..:.|..|.:.|..|
 Frog    35 SMFLFITFSLPVLLALGTQGCPAEC-RCY------SMTVECGSKELRSVPSSIHPSTQTVFLQDN 92

  Fly    83 HIFYLEENAFLTTHLQNLQKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSK 147
            .|..:::  ...:.|..||.|.::|.::..|...:|...|.|:||.|:.|.:..:..::|..|..
 Frog    93 AISQIQQ--LDLSPLSGLQYLYLQNNSISALEPGAFKSQQHLLELALNGNRIHLINSSIFKGLEH 155

  Fly   148 VRAIFLNGNLLQALRHGVFRNLKYLHKIELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLRVE 212
            :|.::|.||.:..|....|.:|:.|.::.|:.|.:.::..:||.|:..|:.:.|..|.:..:...
 Frog   156 LRVLYLAGNQITRLLAYTFSDLQRLQELHLQENSIETLQDQAFSGLSSLALLDLSKNNMRTISRS 220

  Fly   213 SFQDLTKLTALSLVENPWNCTCDLQMFRDFV--IGMNLYT----------PPTSCHYPLQLRGRL 265
            :.:.|..|..|.|.||||.|.|.|...|.::  .|..|.:          ||...|..|      
 Frog   221 ALRPLISLQVLRLTENPWRCDCALHWLRAWIKDEGQRLLSSLDKKIICSEPPRLLHQSL------ 279

  Fly   266 WIEDQPEAFACKPKIVYPTLSTSINTSKENVTLICRVHGSPNTVIAWDYTNQVYESRSKP----V 326
             ::....:..|.|.:|............|.:.:.||..|.|..::.|   .:|..:|:.|    |
 Frog   280 -VDISGNSLVCIPPMVLVEPMEVTARLGEELRVSCRATGYPQPLVTW---RKVSHARTGPPKINV 340

  Fly   327 KSLQKQRIYIELLREDESKIRKFGHDVFVSRLTIVNARKSDEGVYTCLAENPGGKDSV--HISV- 388
            ||...::..:    .:.|...:|........|.:.|...|..|.|.|:|.||||...|  |::| 
 Frog   341 KSTSSRKFEL----SERSVGEQFDAATGSGMLFLNNISMSHAGKYECVASNPGGTAKVLFHLAVN 401

  Fly   389 -------------VVQKDMERISLIDSNFFAIV--CLIAMGFLSMSILFSLVTCLIFKR 432
                         :.|:.:..:..::.|..::.  ..||:|...:::...|:..:|:::
 Frog   402 LSNQQSRTYTSADISQEPLYDLESMEFNALSMATQTAIAIGISLLALTAMLLIVMIYRK 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_001260435.1 leucine-rich repeat 75..99 CDD:275380 5/23 (22%)
LRR_8 99..158 CDD:290566 18/58 (31%)
leucine-rich repeat 100..123 CDD:275380 6/22 (27%)
leucine-rich repeat 124..147 CDD:275380 7/22 (32%)
LRR_8 146..206 CDD:290566 16/59 (27%)
leucine-rich repeat 148..171 CDD:275380 7/22 (32%)
leucine-rich repeat 172..195 CDD:275380 6/22 (27%)
leucine-rich repeat 196..219 CDD:275380 4/22 (18%)
TPKR_C2 228..277 CDD:301599 13/60 (22%)
IG_like 294..390 CDD:214653 28/115 (24%)
Ig 296..387 CDD:143165 26/96 (27%)
lrrc24XP_031759297.1 LRRNT 54..85 CDD:214470 8/37 (22%)
leucine-rich repeat 65..83 CDD:275380 5/17 (29%)
leucine-rich repeat 84..107 CDD:275380 5/24 (21%)
PPP1R42 87..>236 CDD:411060 38/150 (25%)
LRR_8 106..166 CDD:404697 18/59 (31%)
leucine-rich repeat 108..131 CDD:275380 6/22 (27%)
leucine-rich repeat 132..155 CDD:275380 7/22 (32%)
leucine-rich repeat 156..179 CDD:275380 7/22 (32%)
leucine-rich repeat 180..203 CDD:275380 6/22 (27%)
leucine-rich repeat 204..227 CDD:275380 4/22 (18%)
LRRCT 236..289 CDD:214507 13/59 (22%)
Ig_3 291..387 CDD:404760 23/102 (23%)
Ig strand A 291..295 CDD:409353 1/3 (33%)
Ig strand A' 300..304 CDD:409353 0/3 (0%)
Ig strand B 307..316 CDD:409353 3/8 (38%)
Ig strand C 322..328 CDD:409353 1/8 (13%)
Ig strand C' 345..348 CDD:409353 0/2 (0%)
Ig strand D 356..359 CDD:409353 0/2 (0%)
Ig strand E 366..372 CDD:409353 1/5 (20%)
Ig strand F 379..387 CDD:409353 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4612
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14083
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.