Sequence 1: | NP_001260435.1 | Gene: | kek4 / 34718 | FlyBaseID: | FBgn0032484 | Length: | 649 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_951020.1 | Gene: | Slitrk1 / 76965 | MGIID: | 2679446 | Length: | 696 | Species: | Mus musculus |
Alignment Length: | 312 | Identity: | 71/312 - (22%) |
---|---|---|---|
Similarity: | 117/312 - (37%) | Gaps: | 83/312 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 CHCKWNSGKKTADCRNLSLSGVPEYLSPEVQV--LDLSHNHIFYLEENAF------LTTHLQN-- 99
Fly 100 --------------LQKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSKVRA 150
Fly 151 IFLNGNLLQALRHGVFRNLKYLHKIELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLRVESFQ 215
Fly 216 DLTKLTALSLVENPWNCTCDLQMFRDFV--IGMNLYTPPTSCHYPLQLRGRLWIED--------- 269
Fly 270 ------------QPEAFACKPKIVYPTLSTSINTSKENVTLICRVHGSPNTV 309 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek4 | NP_001260435.1 | leucine-rich repeat | 75..99 | CDD:275380 | 8/31 (26%) |
LRR_8 | 99..158 | CDD:290566 | 20/74 (27%) | ||
leucine-rich repeat | 100..123 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 124..147 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 146..206 | CDD:290566 | 13/59 (22%) | ||
leucine-rich repeat | 148..171 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 172..195 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 1/22 (5%) | ||
TPKR_C2 | 228..277 | CDD:301599 | 19/71 (27%) | ||
IG_like | 294..390 | CDD:214653 | 3/16 (19%) | ||
Ig | 296..387 | CDD:143165 | 3/14 (21%) | ||
Slitrk1 | NP_951020.1 | leucine-rich repeat | 39..60 | CDD:275380 | 3/20 (15%) |
LRR 1 | 59..80 | 7/20 (35%) | |||
leucine-rich repeat | 62..83 | CDD:275380 | 6/20 (30%) | ||
LRR 2 | 83..104 | 2/20 (10%) | |||
leucine-rich repeat | 84..107 | CDD:275380 | 2/22 (9%) | ||
LRR 3 | 106..128 | 5/21 (24%) | |||
LRR_8 | 108..166 | CDD:290566 | 19/57 (33%) | ||
leucine-rich repeat | 108..131 | CDD:275380 | 6/22 (27%) | ||
LRR 4 | 131..152 | 8/20 (40%) | |||
leucine-rich repeat | 132..155 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 155..213 | CDD:290566 | 15/81 (19%) | ||
LRR 5 | 155..176 | 8/20 (40%) | |||
leucine-rich repeat | 156..177 | CDD:275380 | 7/20 (35%) | ||
LRR 6 | 178..199 | 6/44 (14%) | |||
TPKR_C2 | 212..>250 | CDD:301599 | 13/37 (35%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 268..317 | 11/49 (22%) | |||
leucine-rich repeat | 356..372 | CDD:275380 | |||
LRR 7 | 376..397 | ||||
leucine-rich repeat | 377..400 | CDD:275380 | |||
LRR 8 | 400..421 | ||||
leucine-rich repeat | 401..424 | CDD:275380 | |||
LRR 9 | 424..445 | ||||
LRR_8 | 425..483 | CDD:290566 | |||
leucine-rich repeat | 425..448 | CDD:275380 | |||
LRR 10 | 448..469 | ||||
leucine-rich repeat | 449..472 | CDD:275380 | |||
LRR_8 | 471..530 | CDD:290566 | |||
LRR 11 | 472..493 | ||||
leucine-rich repeat | 473..495 | CDD:275380 | |||
LRR 12 | 495..516 | ||||
leucine-rich repeat | 496..520 | CDD:275380 | |||
TPKR_C2 | 529..579 | CDD:301599 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |