DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and Slitrk5

DIOPT Version :9

Sequence 1:NP_001260435.1 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001365697.1 Gene:Slitrk5 / 75409 MGIID:2679448 Length:982 Species:Mus musculus


Alignment Length:329 Identity:86/329 - (26%)
Similarity:139/329 - (42%) Gaps:79/329 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 CGN-CHCKWNSGKKTADCRN---LSLSGV-----PEY-----------LSPE-------VQVLDL 79
            |.| |.|:...|..|..|.|   :|||.:     |.|           |.|.       ..:|.|
Mouse    73 CDNACPCEEKDGILTVSCENRGIISLSEISPPRFPIYHLLLSGNLLSRLYPNEFVNYTGASILHL 137

  Fly    80 SHNHIFYLEENAFLTTH-LQNLQKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFD 143
            ..|.|..:|..||   | |:.|::|.:.|..|:.|...:|..|:.|..|.:..|.:..:.||.|.
Mouse   138 GSNVIQDIETGAF---HGLRGLRRLHLNNNKLELLRDDTFLGLENLEYLQVDYNYISVIEPNAFG 199

  Fly   144 CLSKVRAIFLNGNLLQALRHGVFRNLKYLHKIELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTK 208
            .|..::.:.||.|||..|.:.:||.:...| ::|:.|||..:   .:||:               
Mouse   200 KLHMLQVLILNDNLLSGLPNNLFRFVPLTH-LDLRGNRLKLL---PYVGL--------------- 245

  Fly   209 LRVESFQDLTKLTALSLVENPWNCTCDLQMFRDFV--IGMNLYTPPTSCHYPLQLRGRLWIEDQP 271
                 .|.:.|:..|.|.||||||:|:|...:|::  |..:.......|..|.:|.|| .:::..
Mouse   246 -----LQHMDKVVELQLEENPWNCSCELISLKDWLDSISYSALVGDVVCETPFRLHGR-DLDEVS 304

  Fly   272 EAFACKPKIV-------YPTLSTS--INTSKENVTLICRVHGSPNTVIAWDYTNQVYESRSKPVK 327
            :...|..|::       ...|||:  ::|:..:|          |:|..  .::.||:...||.|
Mouse   305 KQELCPRKLISDYEMRPQTPLSTTGYLHTTPASV----------NSVAT--SSSAVYKPPLKPPK 357

  Fly   328 SLQK 331
            ..::
Mouse   358 GTRQ 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_001260435.1 leucine-rich repeat 75..99 CDD:275380 9/24 (38%)
LRR_8 99..158 CDD:290566 17/58 (29%)
leucine-rich repeat 100..123 CDD:275380 7/22 (32%)
leucine-rich repeat 124..147 CDD:275380 7/22 (32%)
LRR_8 146..206 CDD:290566 15/59 (25%)
leucine-rich repeat 148..171 CDD:275380 8/22 (36%)
leucine-rich repeat 172..195 CDD:275380 7/22 (32%)
leucine-rich repeat 196..219 CDD:275380 1/22 (5%)
TPKR_C2 228..277 CDD:301599 14/50 (28%)
IG_like 294..390 CDD:214653 8/38 (21%)
Ig 296..387 CDD:143165 8/36 (22%)
Slitrk5NP_001365697.1 leucine-rich repeat 87..104 CDD:275380 6/16 (38%)
LRR <97..344 CDD:227223 73/286 (26%)
leucine-rich repeat 108..131 CDD:275380 3/22 (14%)
leucine-rich repeat 132..155 CDD:275380 9/25 (36%)
LRR_8 154..214 CDD:404697 17/59 (29%)
leucine-rich repeat 156..179 CDD:275380 7/22 (32%)
leucine-rich repeat 180..203 CDD:275380 7/22 (32%)
leucine-rich repeat 204..225 CDD:275380 8/20 (40%)
leucine-rich repeat 227..251 CDD:275380 8/47 (17%)
PPP1R42 416..>588 CDD:411060
LRR_8 458..518 CDD:404697
leucine-rich repeat 460..483 CDD:275380
leucine-rich repeat 484..507 CDD:275380
leucine-rich repeat 508..553 CDD:275380
leucine-rich repeat 555..579 CDD:275380
TPKR_C2 588..>624 CDD:417692
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.