DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and TPBG

DIOPT Version :9

Sequence 1:NP_001260435.1 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001159864.1 Gene:TPBG / 7162 HGNCID:12004 Length:420 Species:Homo sapiens


Alignment Length:297 Identity:80/297 - (26%)
Similarity:117/297 - (39%) Gaps:62/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 CKWNSGKKTADCRNLSLSGVPEYLSPEVQVLDLSHNHIFYLEENAFL-TTHLQNLQKLLIRNGTL 110
            |:.:...:|..|.|.:|:.||..|...|:.|.|:.|.:..|...||. ...|..|..|.:....|
Human    66 CECSEAARTVKCVNRNLTEVPTDLPAYVRNLFLTGNQLAVLPAGAFARRPPLAELAALNLSGSRL 130

  Fly   111 KYLNQRSFTQLQILIELDLSNNLLVDLLPNVF-------DCLSKVRAIFLN-------------- 154
            ..:...:|..|..|.:||||:|.|.||.|..|       ...|.:..:.||              
Human   131 DEVRAGAFEHLPSLRQLDLSHNPLADLSPFAFSGSNASVSAPSPLVELILNHIVPPEDERQNRSF 195

  Fly   155 -GNLLQALRHGVFRNLKYLHKIELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLRVESFQDLT 218
             |.::.||..|  |.|:.|.::||..|..:.:.......:|.|..:.|.||.|..|...||::||
Human   196 EGMVVAALLAG--RALQGLRRLELASNHFLYLPRDVLAQLPSLRHLDLSNNSLVSLTYVSFRNLT 258

  Fly   219 KLTALSLVE--------------------------NPWNCTCDLQMF------RDFVIGMNLYTP 251
            .|.:|.|.:                          |||.|.|.:...      .:.|.|.:..| 
Human   259 HLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDCHMADMVTWLKETEVVQGKDRLT- 322

  Fly   252 PTSCHYPLQLRGRLWIEDQPEAFACKPKIVYPTLSTS 288
               |.||.::|.|:.:|.......|.| |:.|:|.||
Human   323 ---CAYPEKMRNRVLLELNSADLDCDP-ILPPSLQTS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_001260435.1 leucine-rich repeat 75..99 CDD:275380 7/24 (29%)
LRR_8 99..158 CDD:290566 20/80 (25%)
leucine-rich repeat 100..123 CDD:275380 5/22 (23%)
leucine-rich repeat 124..147 CDD:275380 11/29 (38%)
LRR_8 146..206 CDD:290566 18/74 (24%)
leucine-rich repeat 148..171 CDD:275380 8/37 (22%)
leucine-rich repeat 172..195 CDD:275380 4/22 (18%)
leucine-rich repeat 196..219 CDD:275380 9/22 (41%)
TPKR_C2 228..277 CDD:301599 14/54 (26%)
IG_like 294..390 CDD:214653
Ig 296..387 CDD:143165
TPBGNP_001159864.1 LRRNT 61..95 CDD:214470 9/28 (32%)
leucine-rich repeat 73..95 CDD:275380 8/21 (38%)
LRR 1. /evidence=ECO:0000269|PubMed:24582434 92..113 7/20 (35%)
LRR_8 93..154 CDD:338972 19/60 (32%)
leucine-rich repeat 96..119 CDD:275380 7/22 (32%)
LRR 2. /evidence=ECO:0000269|PubMed:24582434 116..139 4/22 (18%)
leucine-rich repeat 120..143 CDD:275380 5/22 (23%)
LRR 3. /evidence=ECO:0000269|PubMed:24582434 141..163 11/21 (52%)
leucine-rich repeat 144..167 CDD:275380 11/22 (50%)
LRR 4. /evidence=ECO:0000269|PubMed:24582434 172..204 5/31 (16%)
leucine-rich repeat 175..211 CDD:275380 8/37 (22%)
LRR 5. /evidence=ECO:0000269|PubMed:24582434 209..232 5/22 (23%)
LRR_8 211..270 CDD:338972 18/58 (31%)
leucine-rich repeat 212..235 CDD:275380 4/22 (18%)
LRR 6. /evidence=ECO:0000269|PubMed:24582434 233..255 8/21 (38%)
leucine-rich repeat 236..259 CDD:275380 9/22 (41%)
LRR 7. /evidence=ECO:0000269|PubMed:24582434 256..275 5/18 (28%)
leucine-rich repeat 260..283 CDD:275380 3/22 (14%)
LRRCT 294..345 CDD:214507 14/54 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.