Sequence 1: | NP_001260435.1 | Gene: | kek4 / 34718 | FlyBaseID: | FBgn0032484 | Length: | 649 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_080093.1 | Gene: | Tril / 66873 | MGIID: | 1914123 | Length: | 809 | Species: | Mus musculus |
Alignment Length: | 269 | Identity: | 78/269 - (28%) |
---|---|---|---|
Similarity: | 111/269 - (41%) | Gaps: | 37/269 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 WLLDCG--------------NCHCKWNSGKKTADCRNLSLSGVPEYLS-PEVQ-VLDLSHNHIFY 86
Fly 87 LEENAFLTTHLQNLQKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSKVRAI 151
Fly 152 FLNGNLLQALRHGVFRNLKYLHKIELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLRVESFQD 216
Fly 217 LTKLTALSLVENPWNCTCDLQMFRDFVIGMNLYT------------PPTSCHYP----LQLRGRL 265
Fly 266 WIEDQPEAF 274 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek4 | NP_001260435.1 | leucine-rich repeat | 75..99 | CDD:275380 | 8/24 (33%) |
LRR_8 | 99..158 | CDD:290566 | 21/58 (36%) | ||
leucine-rich repeat | 100..123 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 124..147 | CDD:275380 | 11/22 (50%) | ||
LRR_8 | 146..206 | CDD:290566 | 18/59 (31%) | ||
leucine-rich repeat | 148..171 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 172..195 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 6/22 (27%) | ||
TPKR_C2 | 228..277 | CDD:301599 | 16/63 (25%) | ||
IG_like | 294..390 | CDD:214653 | |||
Ig | 296..387 | CDD:143165 | |||
Tril | NP_080093.1 | LRR_RI | <11..194 | CDD:238064 | 54/185 (29%) |
leucine-rich repeat | 37..57 | CDD:275378 | 6/19 (32%) | ||
LRR 1 | 61..81 | 6/19 (32%) | |||
LRR_8 | 84..143 | CDD:290566 | 21/58 (36%) | ||
LRR 2 | 84..105 | 4/20 (20%) | |||
leucine-rich repeat | 85..108 | CDD:275380 | 5/22 (23%) | ||
LRR 3 | 108..129 | 10/20 (50%) | |||
leucine-rich repeat | 109..132 | CDD:275380 | 11/22 (50%) | ||
LRR 4 | 132..153 | 8/20 (40%) | |||
leucine-rich repeat | 133..156 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 156..215 | CDD:290566 | 17/60 (28%) | ||
LRR 5 | 156..177 | 6/20 (30%) | |||
leucine-rich repeat | 157..180 | CDD:275380 | 6/22 (27%) | ||
LRR 6 | 180..201 | 5/20 (25%) | |||
leucine-rich repeat | 181..204 | CDD:275380 | 6/22 (27%) | ||
LRR 7 | 204..223 | 6/20 (30%) | |||
leucine-rich repeat | 205..230 | CDD:275380 | 7/26 (27%) | ||
LRR_RI | 229..>364 | CDD:238064 | 12/45 (27%) | ||
LRR_8 | 229..289 | CDD:290566 | 12/45 (27%) | ||
LRR 8 | 230..251 | 3/20 (15%) | |||
leucine-rich repeat | 231..254 | CDD:275380 | 4/22 (18%) | ||
LRR 9 | 254..275 | 7/20 (35%) | |||
leucine-rich repeat | 255..278 | CDD:275380 | 7/19 (37%) | ||
LRR 10 | 278..298 | ||||
leucine-rich repeat | 279..302 | CDD:275380 | |||
LRR_8 | 302..359 | CDD:290566 | |||
LRR 11 | 302..323 | ||||
leucine-rich repeat | 303..323 | CDD:275380 | |||
LRR 12 | 326..347 | ||||
leucine-rich repeat | 327..350 | CDD:275380 | |||
TPKR_C2 | 359..406 | CDD:301599 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 412..462 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 483..563 | ||||
FN3 | 587..659 | CDD:214495 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |