| Sequence 1: | NP_001260435.1 | Gene: | kek4 / 34718 | FlyBaseID: | FBgn0032484 | Length: | 649 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001165952.1 | Gene: | Aspn / 66695 | MGIID: | 1913945 | Length: | 373 | Species: | Mus musculus |
| Alignment Length: | 206 | Identity: | 51/206 - (24%) |
|---|---|---|---|
| Similarity: | 99/206 - (48%) | Gaps: | 31/206 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 45 CHCKWNSGKKTADCRNLSLSGVPEYLSPEVQVLDLSHNHIFYLEENAFLTTHLQNLQKLLIRNGT 109
Fly 110 LKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSKVRAIFLNGNLLQALRHGVFRNLKYLHK 174
Fly 175 IELKRNRLVS--IDAKAFVGV--------------------PLLSQIYLDNNELTKLRVESFQDL 217
Fly 218 TKLTALSLVEN 228 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek4 | NP_001260435.1 | leucine-rich repeat | 75..99 | CDD:275380 | 8/23 (35%) |
| LRR_8 | 99..158 | CDD:290566 | 15/58 (26%) | ||
| leucine-rich repeat | 100..123 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 124..147 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 146..206 | CDD:290566 | 18/81 (22%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 10/44 (23%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 5/22 (23%) | ||
| TPKR_C2 | 228..277 | CDD:301599 | 1/1 (100%) | ||
| IG_like | 294..390 | CDD:214653 | |||
| Ig | 296..387 | CDD:143165 | |||
| Aspn | NP_001165952.1 | LRRNT | 68..97 | CDD:214470 | 7/28 (25%) |
| leucine-rich repeat | 77..96 | CDD:275380 | 5/18 (28%) | ||
| LRR 1 | 96..117 | 7/22 (32%) | |||
| leucine-rich repeat | 97..120 | CDD:275380 | 8/24 (33%) | ||
| LRR_8 | 98..155 | CDD:290566 | 18/58 (31%) | ||
| LRR 2 | 120..141 | 5/20 (25%) | |||
| leucine-rich repeat | 121..144 | CDD:275380 | 5/22 (23%) | ||
| LRR_RI | <139..333 | CDD:238064 | 32/133 (24%) | ||
| LRR 3 | 144..166 | 7/21 (33%) | |||
| leucine-rich repeat | 145..165 | CDD:275380 | 7/19 (37%) | ||
| Interaction with TGFB1 | 159..205 | 10/48 (21%) | |||
| leucine-rich repeat | 166..189 | CDD:275380 | 4/25 (16%) | ||
| LRR 5 | 189..212 | 8/22 (36%) | |||
| leucine-rich repeat | 190..215 | CDD:275380 | 10/24 (42%) | ||
| LRR_8 | 234..294 | CDD:290566 | 10/35 (29%) | ||
| LRR 6 | 235..255 | 5/19 (26%) | |||
| leucine-rich repeat | 236..259 | CDD:275380 | 5/22 (23%) | ||
| LRR 7 | 259..280 | 4/10 (40%) | |||
| leucine-rich repeat | 260..283 | CDD:275380 | 4/9 (44%) | ||
| LRR 8 | 283..305 | ||||
| LRR 9 | 306..327 | ||||
| leucine-rich repeat | 307..331 | CDD:275380 | |||
| LRR 10 | 328..349 | ||||
| leucine-rich repeat | 332..359 | CDD:275380 | |||
| LRR 11 | 350..373 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||