DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and LRFN1

DIOPT Version :10

Sequence 1:NP_609615.2 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_065913.1 Gene:LRFN1 / 57622 HGNCID:29290 Length:771 Species:Homo sapiens


Alignment Length:400 Identity:89/400 - (22%)
Similarity:149/400 - (37%) Gaps:69/400 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LALIFRSASADWLLDC-GNCHCKWNSGKKTADCRNLSLSGVPEYLSPEVQVLDLSHNHIFYLEEN 90
            |.|::..||..  ..| |.|.|:..:...|..|....|..||..:...|..|.|:.|.|..:...
Human    21 LLLLWAGASRG--QPCPGRCICQNVAPTLTMLCAKTGLLFVPPAIDRRVVELRLTDNFIAAVRRR 83

  Fly    91 AFLTTHLQNLQKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSKVRAIFLNG 155
            .|  .::.:|..|.:...|:..:...:|..|:.|..|.|.:|.|.::..:....|..:|.:.|..
Human    84 DF--ANMTSLVHLTLSRNTIGQVAAGAFADLRALRALHLDSNRLAEVRGDQLRGLGNLRHLILGN 146

  Fly   156 NLLQALRHGVF-RNLKYLHKIELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLRVESFQDLTK 219
            |.::.:....| ..|..:..::|..|.|.::..:|...:..|:.:.||:|.:..:...:|..|.|
Human   147 NQIRRVESAAFDAFLSTVEDLDLSYNNLEALPWEAVGQMVNLNTLTLDHNLIDHIAEGTFVQLHK 211

  Fly   220 LTALSLVE--------------------------------NPWNCTCDLQMFRDFVIGMNLYTPP 252
            |..|.:..                                ||.:|.|:|...|......:|.|  
Human   212 LVRLDMTSNRLHKLPPDGLFLRSQGTGPKPPTPLTVSFGGNPLHCNCELLWLRRLTREDDLET-- 274

  Fly   253 TSCHYPLQLRGRLWIEDQPEAFACKPKIVYPTL-STSINTSKENVTLICRVHGSPNTVIAWDYTN 316
              |..|..|..|.:.....|.|.|:|.::.... ..::....:.|:|.||..|.|..|:.|    
Human   275 --CATPEHLTDRYFWSIPEEEFLCEPPLITRQAGGRALVVEGQAVSLRCRAVGDPEPVVHW---- 333

  Fly   317 QVYESRSKPVKSLQKQRIYIELLREDESKIRKFGH-DVFVSRLTIVNARKSDEGVYTCLAENPGG 380
                  ..|...|        |.....:::|..|. ||.::.|       .|.|.:||:|.|..|
Human   334 ------VAPDGRL--------LGNSSRTRVRGDGTLDVTITTL-------RDSGTFTCIASNAAG 377

  Fly   381 KDSVHISVVV 390
            :.:..:.|.|
Human   378 EATAPVEVCV 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_609615.2 LRR 59..>228 CDD:443914 38/201 (19%)
leucine-rich repeat 75..99 CDD:275380 5/23 (22%)
LRR_8 98..158 CDD:404697 14/59 (24%)
leucine-rich repeat 100..123 CDD:275380 5/22 (23%)
leucine-rich repeat 124..147 CDD:275380 6/22 (27%)
leucine-rich repeat 148..171 CDD:275380 5/23 (22%)
leucine-rich repeat 172..195 CDD:275380 4/22 (18%)
leucine-rich repeat 196..219 CDD:275380 6/22 (27%)
LRRCT 228..277 CDD:214507 14/48 (29%)
IG_like 294..390 CDD:214653 24/96 (25%)
Ig strand B 296..300 CDD:409353 2/3 (67%)
Ig strand C 309..323 CDD:409353 2/13 (15%)
Ig strand E 356..360 CDD:409353 1/3 (33%)
Ig strand F 370..375 CDD:409353 2/4 (50%)
Ig strand G 383..386 CDD:409353 0/2 (0%)
LRFN1NP_065913.1 PDZ-binding 768..771
LRR 1 66..87 6/22 (27%)
leucine-rich repeat 67..90 CDD:275380 6/24 (25%)
LRR <69..326 CDD:443914 54/262 (21%)
LRR 2 90..111 4/20 (20%)
leucine-rich repeat 91..114 CDD:275380 5/22 (23%)
LRR 3 114..135 5/20 (25%)
leucine-rich repeat 115..138 CDD:275380 6/22 (27%)
LRR 4 138..159 4/20 (20%)
leucine-rich repeat 139..163 CDD:275380 5/23 (22%)
LRR 5 163..184 4/20 (20%)
leucine-rich repeat 164..187 CDD:275380 4/22 (18%)
LRR 6 187..208 5/20 (25%)
leucine-rich repeat 188..211 CDD:275380 6/22 (27%)
LRR 7 211..232 3/20 (15%)
leucine-rich repeat 212..230 CDD:275380 2/17 (12%)
Ig 299..387 CDD:472250 24/112 (21%)
Ig strand B 317..321 CDD:409353 2/3 (67%)
Ig strand C 330..334 CDD:409353 2/13 (15%)
Ig strand E 353..357 CDD:409353 1/3 (33%)
Ig strand F 367..372 CDD:409353 2/4 (50%)
Ig strand G 380..383 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..422
fn3 426..500 CDD:394996
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 654..743
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.