| Sequence 1: | NP_001260435.1 | Gene: | kek4 / 34718 | FlyBaseID: | FBgn0032484 | Length: | 649 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_021325623.1 | Gene: | lrrc38a / 567935 | ZFINID: | ZDB-GENE-080327-12 | Length: | 290 | Species: | Danio rerio |
| Alignment Length: | 211 | Identity: | 57/211 - (27%) |
|---|---|---|---|
| Similarity: | 92/211 - (43%) | Gaps: | 35/211 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 31 FRSASADWLLDCG-----NCHCKWNSGKKTADCRNLSLSGVPEYLSPEVQVLDLSHNHIFYLEEN 90
Fly 91 AFLTTHLQNLQKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSKVRAIFLNG 155
Fly 156 NLLQALRHGVFRNLKYLHKIELKRNRLVSIDAK-AFVGVPLLSQIYLDNNELTKLRVESFQDLTK 219
Fly 220 LTALSLVENPWNCTCD 235 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek4 | NP_001260435.1 | leucine-rich repeat | 75..99 | CDD:275380 | 7/23 (30%) |
| LRR_8 | 99..158 | CDD:290566 | 12/58 (21%) | ||
| leucine-rich repeat | 100..123 | CDD:275380 | 0/22 (0%) | ||
| leucine-rich repeat | 124..147 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 146..206 | CDD:290566 | 17/60 (28%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 8/23 (35%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 8/22 (36%) | ||
| TPKR_C2 | 228..277 | CDD:301599 | 5/8 (63%) | ||
| IG_like | 294..390 | CDD:214653 | |||
| Ig | 296..387 | CDD:143165 | |||
| lrrc38a | XP_021325623.1 | LRRNT | 26..56 | CDD:214470 | 7/32 (22%) |
| leucine-rich repeat | 36..58 | CDD:275380 | 6/21 (29%) | ||
| leucine-rich repeat | 59..79 | CDD:275380 | 7/20 (35%) | ||
| PLN00113 | <60..>185 | CDD:331614 | 39/150 (26%) | ||
| leucine-rich repeat | 80..103 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 102..163 | CDD:316378 | 17/60 (28%) | ||
| leucine-rich repeat | 104..127 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 128..152 | CDD:275380 | 8/23 (35%) | ||
| leucine-rich repeat | 153..176 | CDD:275380 | 8/22 (36%) | ||
| TPKR_C2 | 185..>219 | CDD:326558 | 5/8 (63%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||