DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and Lingo4

DIOPT Version :10

Sequence 1:NP_609615.2 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001102659.1 Gene:Lingo4 / 499668 RGDID:1562025 Length:618 Species:Rattus norvegicus


Alignment Length:595 Identity:113/595 - (18%)
Similarity:178/595 - (29%) Gaps:200/595 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ASADWLLDCGNCHCKWNSGKKTADCRNLSLSGVPEYLSPEVQVLDLSHNHIFYLEENAFLTTHLQ 98
            :|...|.||       .|..:...|.:..|..||..|..:.:|||||.|.::.|:..  :.:.|.
  Rat    54 SSCPTLCDC-------TSQTRAVLCAHRRLDTVPGGLPLDTEVLDLSGNRLWGLQRG--MLSRLG 109

  Fly    99 NLQKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSKVRAIFLNGNLLQALRH 163
            .||:|.:....|..|...:|..||.|:.|.|..|.|..:.|.:|..||.:..:.|..|.:.....
  Rat   110 QLQELDLSYNQLSTLEPGAFHGLQSLLTLRLQGNRLRIVGPGIFSGLSALTLLDLRLNQIVLFLD 174

  Fly   164 GVFRNLKYLHKIELKRNRLVSIDAKAFVGVPLLSQIYLDNNE----------------------- 205
            |.|..|..|.::|:..|.||.:...||.|:..||.|.|:...                       
  Rat   175 GAFGELGSLQQLEVGDNHLVFVAPGAFSGLAKLSTITLERCNLSTVPGLALAQLPALVALRLREL 239

  Fly   206 ----------------------------------------------------------------- 205
                                                                             
  Rat   240 DIERLPSGALRGLGQLKELEIHHWPSLEALDPGSLVGLNLSSLAITHCNLSSVPFQALHHLSFLQ 304

  Fly   206 --------------------------------LTKLRVESFQDLT-------------------- 218
                                            ||.:...:|..||                    
  Rat   305 VLDLSQNPISAIPARRLSPLVRLQELRLSGACLTSIAAHAFHGLTAFHLLDVADNALQTLEETAF 369

  Fly   219 ----KLTALSLVENPWNCTCDLQMFRDFVIGMNLYTPPTSCHYPLQLRGRLWIEDQ----PEAFA 275
                ||..|.|..||..|.|.|.........::..|.|.:|..|..::|:...|..    |..|.
  Rat   370 PSPDKLVTLRLSGNPLTCDCRLLWLLRLRRRLDFGTSPPACAGPQHVQGKNLREFSDILPPGHFT 434

  Fly   276 CKPKIVYPTLSTSINTSK-ENVTLICRVHGSPNTVIAWDYTNQVYESRSKPVKSLQKQRIYIELL 339
            |||.::..:....:...: .:....|...|.|...::|......:..|...|:.|          
  Rat   435 CKPALIRKSGPRWVIAEEGGHAVFSCSGDGDPAPTVSWMRPQGSWLGRVGRVRVL---------- 489

  Fly   340 REDESKIRKFGHDVFVSRLTIVNARKSDEGVYTCLAENPGGKDSVHISV-VVQKDMERISLIDSN 403
             ||             ..|.|.:.:..|.|.|.|:..|..|.||:...: |:|.:....:|.|.|
  Rat   490 -ED-------------GTLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPN 540

  Fly   404 FF-------------AIVCLIAMGFL----SMSILFSLVTCLIFKRFKQFHPGQHTYLQPTSLPV 451
            ..             .:..::|:|||    |:::.|.|:......:.:..|.....::.|.....
  Rat   541 VTMPGIPGPFSLDSRGVAMVLAVGFLPFLTSVTLCFGLIALWSKGKGRVKHHMTFDFVAPRPSGD 605

  Fly   452 QSPGSEEATA 461
            ::.|....||
  Rat   606 KNSGGNRVTA 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_609615.2 LRR 59..>228 CDD:443914 55/312 (18%)
leucine-rich repeat 75..99 CDD:275380 8/23 (35%)
LRR_8 98..158 CDD:404697 19/59 (32%)
leucine-rich repeat 100..123 CDD:275380 7/22 (32%)
leucine-rich repeat 124..147 CDD:275380 8/22 (36%)
leucine-rich repeat 148..171 CDD:275380 5/22 (23%)
leucine-rich repeat 172..195 CDD:275380 8/22 (36%)
leucine-rich repeat 196..219 CDD:275380 9/166 (5%)
LRRCT 228..277 CDD:214507 13/52 (25%)
IG_like 294..390 CDD:214653 19/96 (20%)
Ig strand B 296..300 CDD:409353 0/3 (0%)
Ig strand C 309..323 CDD:409353 1/13 (8%)
Ig strand E 356..360 CDD:409353 1/3 (33%)
Ig strand F 370..375 CDD:409353 2/4 (50%)
Ig strand G 383..386 CDD:409353 1/2 (50%)
Lingo4NP_001102659.1 leucine-rich repeat 87..110 CDD:275380 8/24 (33%)
LRR <88..441 CDD:443914 67/354 (19%)
leucine-rich repeat 111..134 CDD:275380 7/22 (32%)
leucine-rich repeat 135..158 CDD:275380 8/22 (36%)
leucine-rich repeat 159..182 CDD:275380 5/22 (23%)
leucine-rich repeat 183..206 CDD:275380 8/22 (36%)
leucine-rich repeat 207..230 CDD:275380 4/22 (18%)
leucine-rich repeat 231..254 CDD:275380 0/22 (0%)
leucine-rich repeat 255..302 CDD:275380 0/46 (0%)
leucine-rich repeat 303..326 CDD:275380 0/22 (0%)
leucine-rich repeat 327..348 CDD:275380 3/20 (15%)
leucine-rich repeat 351..374 CDD:275380 0/22 (0%)
IG_like 445..526 CDD:214653 19/104 (18%)
Ig strand B 456..460 CDD:409353 0/3 (0%)
Ig strand C 469..473 CDD:409353 0/3 (0%)
Ig strand E 492..496 CDD:409353 1/3 (33%)
Ig strand F 506..511 CDD:409353 2/4 (50%)
Ig strand G 519..522 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.