DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and Lrit2

DIOPT Version :9

Sequence 1:NP_001260435.1 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001178867.1 Gene:Lrit2 / 498594 RGDID:1564668 Length:549 Species:Rattus norvegicus


Alignment Length:514 Identity:122/514 - (23%)
Similarity:190/514 - (36%) Gaps:152/514 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FKIYCLALIFRSASADWL------LDCGNCHCKWNSGKKTADCRNLSLSGVPEYLSPEVQVLDLS 80
            |..||    |......|:      |....|.|...|..::..|.::||..:|:.....::.:.:.
  Rat     3 FVFYC----FLQVLVSWVTHAARPLCLSECTCSEESFGRSLQCMSMSLGKIPDNFPEGLKQVRIE 63

  Fly    81 HNHIFYLEENAFLTTHLQNLQKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCL 145
            .:.:|.|.:..|  |:|..|:.|        :||..:.|.:.:                ...:.|
  Rat    64 KSPLFELPQGVF--TNLNTLEYL--------WLNFNNVTVIHL----------------GALEDL 102

  Fly   146 SKVRAIFLNGNLLQALRHGVFRNLKYLHKIELKRNRLVSIDAKAFVGVPLLSQI-YLD--NNELT 207
            .::|.:.|.||.|:::....||...:|..::||.||   |||...:.:..|:.: |||  :|.||
  Rat   103 PQLRELRLEGNRLRSVPWTAFRATPFLRVLDLKHNR---IDALPELALQFLANLTYLDISSNRLT 164

  Fly   208 K------LRVESFQDLTKL---------TALSLVENPWNCTCDLQMFRDFVIGMNLYTPP----- 252
            .      |...::|...:|         ..|||..|||.|.|.|.....||..:.   ||     
  Rat   165 VVSKGVFLNWPAYQKRQQLGCGAEILSHMVLSLHNNPWLCDCRLTGLAQFVKSVG---PPFILVN 226

  Fly   253 --TSCHYPLQLRGRLWIEDQPEAFAC-KPKIVYPTLSTSINTSKENVTLICRVHGSPNTVIAWDY 314
              ..|..|:...|:|..|  .|...| ||.|..|:.:.||...| ||||.|....||:..|.|.|
  Rat   227 SYLICQGPVSKAGQLLHE--TELGDCMKPIISTPSANVSIQVGK-NVTLQCLAQASPSPTIEWKY 288

  Fly   315 ---TNQVYESRSKPVKSLQKQRIYIELLREDESKIRKFGHDVFVSRLTIVNARKSDEGVYTCLAE 376
               |.:.::..:.||                       .....:|:|.|..|:..|...|||:|.
  Rat   289 PLSTWRKFDVLALPV-----------------------AEGFILSQLVIPAAQLVDGTNYTCMAS 330

  Fly   377 NPGGKDSVHISVVVQKDMERISLIDSNFFAIVCLIAMGFLSMSILFSLVTCLIFKRFKQFHPGQH 441
            |..|:.|:.|::.||.                                         .|..||.|
  Rat   331 NSIGRSSLVITLYVQP-----------------------------------------AQATPGLH 354

  Fly   442 TYLQPTSLPVQSPGSEEATAISALSSGVIRES--KIVLDPLSAINEPSNKNYTLFKTSN 498
                  ||...|.||      |.:...|::::  .|:|:.|:..|....:.:||:..|:
  Rat   355 ------SLSTSSEGS------SYVDLRVVKQTVHGILLEWLTVTNLAGEQWFTLYIASD 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_001260435.1 leucine-rich repeat 75..99 CDD:275380 5/23 (22%)
LRR_8 99..158 CDD:290566 10/58 (17%)
leucine-rich repeat 100..123 CDD:275380 5/22 (23%)
leucine-rich repeat 124..147 CDD:275380 1/22 (5%)
LRR_8 146..206 CDD:290566 20/62 (32%)
leucine-rich repeat 148..171 CDD:275380 7/22 (32%)
leucine-rich repeat 172..195 CDD:275380 8/22 (36%)
leucine-rich repeat 196..219 CDD:275380 9/31 (29%)
TPKR_C2 228..277 CDD:301599 17/56 (30%)
IG_like 294..390 CDD:214653 26/98 (27%)
Ig 296..387 CDD:143165 24/93 (26%)
Lrit2NP_001178867.1 LRR_8 56..115 CDD:290566 15/84 (18%)
leucine-rich repeat 57..80 CDD:275378 5/24 (21%)
LRR_4 81..119 CDD:289563 11/61 (18%)
leucine-rich repeat 81..104 CDD:275378 6/46 (13%)
LRR_8 103..163 CDD:290566 20/62 (32%)
leucine-rich repeat 105..128 CDD:275378 7/22 (32%)
LRR_4 129..164 CDD:289563 13/37 (35%)
leucine-rich repeat 129..152 CDD:275378 9/25 (36%)
leucine-rich repeat 153..164 CDD:275378 4/10 (40%)
leucine-rich repeat 177..204 CDD:275378 8/26 (31%)
TPKR_C2 200..243 CDD:301599 14/45 (31%)
I-set 253..344 CDD:254352 32/114 (28%)
Ig 270..341 CDD:143165 24/93 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BAUD
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.