DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and LRRC24

DIOPT Version :9

Sequence 1:NP_001260435.1 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001019849.2 Gene:LRRC24 / 441381 HGNCID:28947 Length:513 Species:Homo sapiens


Alignment Length:390 Identity:103/390 - (26%)
Similarity:164/390 - (42%) Gaps:43/390 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LFKIYCLALIFRSASADWLLDCGNCHCKWNSGKKTADCRNLSLSGVPEYLSPEVQVLDLSHNHIF 85
            |..:..|.|..|:|...     ..|.|.    ..|.:|..|.|..||..:.|..|.|.|..|:|.
Human     8 LLPLLLLLLPLRAAGCP-----AACRCY----SATVECGALRLRVVPLGIPPGTQTLFLQDNNIA 63

  Fly    86 YLEENAFLTTHLQNLQKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSKVRA 150
            .||..|.  ..|..|::|.:.|.:|:.|...:|.....|:||.|::|.|..|....|..|:::|.
Human    64 RLEPGAL--APLAALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRSGAFVGLAQLRV 126

  Fly   151 IFLNGNLLQALRHGVFRNLKYLHKIELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLRVESFQ 215
            ::|.||.|..|....|.:|..|.::.|:.|.:..::.:|..|:..|:.:.|..|:|..:..|:.|
Human   127 LYLAGNQLARLLDFTFLHLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQ 191

  Fly   216 DLTKLTALSLVENPWNCTCDLQMFRDFVI--GMNLYTP---PTSCHYPLQLRGRLWIEDQPEAFA 275
            .|..|..|.|.||||.|.|.|.....::.  |..|.|.   ...|..|.:|..:..::....:..
Human   192 PLASLQVLRLTENPWRCDCALHWLGAWIKEGGQRLLTSRDRKIMCAEPPRLALQSLLDVSHSSLI 256

  Fly   276 CKPKIVY-PTLSTSINTSKENVTLICRVHGSPNTVIAWDYTNQVYESRSKPVKSLQKQRIYIELL 339
            |.|..|: ..|..:.|.. |::.:.|:..|.|..::.|....|..|.|.:....|:...:.:.  
Human   257 CIPPSVHVQPLELTANLG-EDLRVACQASGYPQPLVTWRKVPQPREGRPRAQAQLEGGLLGLG-- 318

  Fly   340 REDESKIRKFGHD--------VFVSRLTIVNARKSDEGVYTCLAENPGGKDSVHISVVVQKDMER 396
                      ||.        :|:|.:|:.:|     |.|.|.|.|.||...|...::|....::
Human   319 ----------GHSASDTGSGMLFLSNITLAHA-----GKYECEASNAGGAARVPFRLLVNASRQQ 368

  Fly   397  396
            Human   369  368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_001260435.1 leucine-rich repeat 75..99 CDD:275380 9/23 (39%)
LRR_8 99..158 CDD:290566 19/58 (33%)
leucine-rich repeat 100..123 CDD:275380 6/22 (27%)
leucine-rich repeat 124..147 CDD:275380 9/22 (41%)
LRR_8 146..206 CDD:290566 16/59 (27%)
leucine-rich repeat 148..171 CDD:275380 8/22 (36%)
leucine-rich repeat 172..195 CDD:275380 5/22 (23%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
TPKR_C2 228..277 CDD:301599 12/53 (23%)
IG_like 294..390 CDD:214653 23/103 (22%)
Ig 296..387 CDD:143165 22/98 (22%)
LRRC24NP_001019849.2 LRR_RI 49..>158 CDD:238064 36/110 (33%)
LRR_8 <50..86 CDD:290566 13/37 (35%)
LRR 1 51..72 8/22 (36%)
leucine-rich repeat 53..75 CDD:275380 9/23 (39%)
LRR 2 75..96 6/20 (30%)
LRR_8 76..134 CDD:290566 19/57 (33%)
leucine-rich repeat 76..99 CDD:275380 6/22 (27%)
LRR 3 99..120 8/20 (40%)
leucine-rich repeat 100..123 CDD:275380 9/22 (41%)
LRR_8 123..205 CDD:290566 24/81 (30%)
LRR 4 123..144 7/20 (35%)
leucine-rich repeat 124..147 CDD:275380 8/22 (36%)
LRR 5 147..168 4/20 (20%)
leucine-rich repeat 148..171 CDD:275380 5/22 (23%)
LRR 6 171..192 5/20 (25%)
leucine-rich repeat 172..195 CDD:275380 7/22 (32%)
LRRCT 204..257 CDD:214507 12/52 (23%)
Ig 259..364 CDD:299845 28/122 (23%)
IG_like 266..362 CDD:214653 25/113 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..391 0/4 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4858
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.