DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and rtn4rl2b

DIOPT Version :9

Sequence 1:NP_001260435.1 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_982350.1 Gene:rtn4rl2b / 403309 ZFINID:ZDB-GENE-040310-2 Length:457 Species:Danio rerio


Alignment Length:402 Identity:87/402 - (21%)
Similarity:156/402 - (38%) Gaps:90/402 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WLLDCGNCH--------CKWNSGKKTADCRNLSLSGVP----------------------EYLSP 72
            |||.| .|.        |.......|..|::.:.:.||                      :....
Zfish    29 WLLAC-RCAPGQACPRLCVCYHMPMTVSCQSQNFTSVPAGVPYDSQRVFLQNNRITELRADSFGF 92

  Fly    73 EVQVLDLSHNHIFYLEENAFLTTHLQNLQKL-LIRNGTLKYLNQRSFTQLQILIELD-------- 128
            |.|||.|..|:|.::|..||  ::|:.|::| |..|.:|:.|:..:|..|:.|..|.        
Zfish    93 ETQVLWLYSNNITWIEAGAF--SNLRVLEELDLSDNPSLRRLDGGAFRGLERLQSLHMHRCHLTE 155

  Fly   129 ----------------LSNNLLVDLLPNVFDCLSKVRAIFLNGNLLQALRHGVFRNLKYLHKIEL 177
                            |..|.|.:|...:|..|..:..:||:||.::.:....||.|..|.::.|
Zfish   156 LPADLFHKLYSLQFLYLQENQLTNLPDGLFSDLVNLTHLFLHGNRIRTVSENAFRGLVNLDRLLL 220

  Fly   178 KRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLRVESFQDLTKLTALSLVENPWNCTCDLQMFRDF 242
            ..||:..:..::|..:..|:.:||.||.|.:|..::.:|.:.:..|.|..|||.|.|:.:...::
Zfish   221 HDNRIRQVHRRSFRDLGRLTILYLFNNSLQELPGQALRDTSSVQFLRLNGNPWTCGCEARSLWEW 285

  Fly   243 VIGMNLYTPPTSCHYPLQLRGR-LWIEDQPEAFAC---KPKIVYPTLSTSINT--------SKEN 295
            .....:.:...:|..|...:|: |....:.:...|   .|..:..|.:|:.:|        :|..
Zfish   286 FRKARISSSDLTCSSPAPRKGQDLRFLRELDFALCPLPDPGSMAGTTTTTFSTKTRWWFSKNKPA 350

  Fly   296 VTLICRVHGSPNTVIAWDYTNQVYESRSK--------------PVKSLQKQRIYIELLREDESKI 346
            .:.....|.|..|:.|:.:.:....|.|.              .:..|:.:..:.....||.:.:
Zfish   351 SSSKSHFHKSSETLKAFPFNSGKNPSSSSTSFSSKYDLTAEEAALPKLEPEEYWANYGNEDAASV 415

  Fly   347 RKF------GHD 352
            |.|      |:|
Zfish   416 RCFELECPPGYD 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_001260435.1 leucine-rich repeat 75..99 CDD:275380 10/23 (43%)
LRR_8 99..158 CDD:290566 20/83 (24%)
leucine-rich repeat 100..123 CDD:275380 8/23 (35%)
leucine-rich repeat 124..147 CDD:275380 8/46 (17%)
LRR_8 146..206 CDD:290566 17/59 (29%)
leucine-rich repeat 148..171 CDD:275380 7/22 (32%)
leucine-rich repeat 172..195 CDD:275380 5/22 (23%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)
TPKR_C2 228..277 CDD:301599 10/52 (19%)
IG_like 294..390 CDD:214653 13/79 (16%)
Ig 296..387 CDD:143165 13/77 (17%)
rtn4rl2bNP_982350.1 LRRNT 40..71 CDD:214470 5/30 (17%)
leucine-rich repeat 53..70 CDD:275380 4/16 (25%)
leucine-rich repeat 73..93 CDD:275380 0/19 (0%)
LRR_RI 93..>326 CDD:238064 59/234 (25%)
LRR_8 95..153 CDD:290566 20/59 (34%)
leucine-rich repeat 95..117 CDD:275380 10/23 (43%)
leucine-rich repeat 118..142 CDD:275380 8/23 (35%)
leucine-rich repeat 143..166 CDD:275380 2/22 (9%)
LRR_8 166..225 CDD:290566 16/58 (28%)
LRR_4 166..206 CDD:289563 10/39 (26%)
leucine-rich repeat 167..190 CDD:275380 6/22 (27%)
leucine-rich repeat 191..214 CDD:275380 7/22 (32%)
LRR_8 214..272 CDD:290566 15/57 (26%)
leucine-rich repeat 215..238 CDD:275380 5/22 (23%)
leucine-rich repeat 239..262 CDD:275380 8/22 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.