DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and chad

DIOPT Version :9

Sequence 1:NP_001260435.1 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_957357.1 Gene:chad / 394038 ZFINID:ZDB-GENE-040426-1130 Length:363 Species:Danio rerio


Alignment Length:352 Identity:79/352 - (22%)
Similarity:140/352 - (39%) Gaps:88/352 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LFKIYCLALIFRSASADWLLDCGNCHCKWNSGKKTADCRNLSLSGVPEYLSPEVQVLDLSHNHIF 85
            |..:.||.....:|.|........|||  :...:...|.|:.|..:|. :|...::|:|..|::.
Zfish     7 LLVLVCLQFCAHTAFAAPTQCPSQCHC--HGDLQHVICDNVGLKKIPR-ISEATRLLNLQRNNLG 68

  Fly    86 YLEENAF------LTTHLQNLQKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDC 144
            .|....|      ::.|||:.|        ::.|:.::|..|..||.|.||:|.:..:.|..|:.
Zfish    69 NLPTGGFSEMKGLISLHLQHCQ--------IRELSGQAFKGLNKLIYLYLSDNEISTIKPGAFED 125

  Fly   145 LSKVRAIFLNGNLLQALRHGVFRNLKYLHKIELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKL 209
            |:::..::|:||.:.:|..|:|..:..|..::|..|:|..:....|.|...|..:|:..|||:.:
Zfish   126 LTELTYLYLDGNQITSLPKGIFSPMINLFILQLNNNKLRELQPGTFKGAKDLRWLYMSGNELSSI 190

  Fly   210 RVESFQDLTKLTALSLVENPWNCTCDLQMFRDFVIGMNLYTPPTSCHYPLQLRGRLWIEDQPEAF 274
            :..|..::..|..|:|.:|                  ||.|      |||....:|.:.::    
Zfish   191 QPGSLDEVENLAILTLDQN------------------NLST------YPLLAMSKLRVVEE---- 227

  Fly   275 ACKPKIVYPTLSTSINTSKENVTLICRVHGSPNTVIAWDYTNQVYESRSKPVKSLQKQRIYIELL 339
                          :|.||..::||                         |..:.:....|:|.|
Zfish   228 --------------LNLSKNPLSLI-------------------------PDHAFRSFGRYMEKL 253

  Fly   340 REDESKIRKFGHDVFVSRLTIVNARKS 366
            ..::..:.||.:..|..    |.|.||
Zfish   254 HLNDMSLEKFSNAAFEG----VTALKS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_001260435.1 leucine-rich repeat 75..99 CDD:275380 7/29 (24%)
LRR_8 99..158 CDD:290566 16/58 (28%)
leucine-rich repeat 100..123 CDD:275380 4/22 (18%)
leucine-rich repeat 124..147 CDD:275380 9/22 (41%)
LRR_8 146..206 CDD:290566 15/59 (25%)
leucine-rich repeat 148..171 CDD:275380 6/22 (27%)
leucine-rich repeat 172..195 CDD:275380 6/22 (27%)
leucine-rich repeat 196..219 CDD:275380 6/22 (27%)
TPKR_C2 228..277 CDD:301599 8/48 (17%)
IG_like 294..390 CDD:214653 13/73 (18%)
Ig 296..387 CDD:143165 13/71 (18%)
chadNP_957357.1 LRRNT 26..52 CDD:279764 6/27 (22%)
leucine-rich repeat 57..80 CDD:275380 5/22 (23%)
LRR_8 79..139 CDD:290566 19/67 (28%)
leucine-rich repeat 81..104 CDD:275380 7/30 (23%)
LRR_RI <96..304 CDD:238064 56/252 (22%)
LRR_4 104..143 CDD:289563 12/38 (32%)
leucine-rich repeat 105..128 CDD:275380 9/22 (41%)
LRR_8 127..187 CDD:290566 15/59 (25%)
leucine-rich repeat 129..152 CDD:275380 6/22 (27%)
leucine-rich repeat 153..176 CDD:275380 6/22 (27%)
LRR_8 177..235 CDD:290566 20/99 (20%)
leucine-rich repeat 177..200 CDD:275380 6/22 (27%)
leucine-rich repeat 201..224 CDD:275380 11/46 (24%)
LRR_8 225..284 CDD:290566 16/99 (16%)
leucine-rich repeat 225..248 CDD:275380 6/65 (9%)
leucine-rich repeat 250..273 CDD:275380 6/26 (23%)
LRRCT 304..351 CDD:214507
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.