DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and lbk

DIOPT Version :9

Sequence 1:NP_001260435.1 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster


Alignment Length:858 Identity:182/858 - (21%)
Similarity:292/858 - (34%) Gaps:312/858 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LKHLSLFLFK----IYCLALIFRSASADW-----LLDCGNCHCKWNSGKKTADCRNLSLSGVPEY 69
            |..|.:.:||    :..|||.|.....:|     |....|...|.|..:...|       || .|
  Fly   421 LSTLPIRVFKNLNQLKKLALNFNQLEINWSTFRGLESMKNLQLKSNKIRALQD-------GV-FY 477

  Fly    70 LSPEVQVLDLSHNHIFYLEENAFLTTHLQNLQKLLIRNGTLKY-------LNQRSFTQ-LQILIE 126
            :..:::.:||:.|.|..|....     |.||.||  |:..|.:       ::...||| |::   
  Fly   478 VMHKIETIDLAMNQISSLSRQG-----LFNLTKL--RHLNLSFNAISRIEVDTWEFTQSLEV--- 532

  Fly   127 LDLSNNLLVDLLPNVFDCLSKVRAIFLNGNLLQALRHGVFRNLKYLHKIELKRNR---------- 181
            ||||||.:.:..|...|||.:::.:.|..|.||.|:...|..:|.|.::.|:|||          
  Fly   533 LDLSNNAINEFKPQHLDCLHRLKTLNLAHNRLQYLQENTFDCVKNLEELNLRRNRLSWIIEDQSA 597

  Fly   182 -------------------LVSIDAKAFVGVPLLSQIYLDNNELTKLRVESFQDLTKLTALSLVE 227
                               |..|..||..|:..|..:.|.:|.|..::|.:|:.:.:|..|....
  Fly   598 AAPFKGLRKLRRLDLHGNNLKQISTKAMSGLNNLEILNLGSNALASIQVNAFEHMLRLNKLVFKS 662

  Fly   228 NPWNCTCDLQMFRDFVIGMNLYTPPTS---CHYPLQLRGR---------LWIEDQPEAFACKPKI 280
            ..:.|.|||..|:.::  .|.:.....   |.||..|..|         |...|.|     ||::
  Fly   663 LNFICDCDLVWFQQWL--KNRFPQQAEHAVCGYPEHLLDRHLKSLSSSELVCVDSP-----KPRV 720

  Fly   281 VY-PTLSTSINTSKENVTLICRVHGSPNTV---------IAWDYTNQ------------------ 317
            .. |....::|.:  |:||.| :..||...         |.|.:.||                  
  Fly   721 EQEPDDMLAVNAA--NITLEC-IASSPTAASLAAADELKIKWRHDNQHVQERPAVHDGASTETQI 782

  Fly   318 --------------------VYES--RSKPVKS-------LQKQRIYI----------------- 336
                                .|||  |.:.|.|       .||.:|.|                 
  Fly   783 RHDLSTNQTSIYGYLRLTNVTYESAGRYQCVVSNAFGTTYAQKFKISIGIHPTFLQVPSNLTLDA 847

  Fly   337 -ELLR---------EDESKIRKFGHDVFVS----RLTIV---------NARKSDEGVYTCLAENP 378
             |:.|         ..|..::|||...|.:    ||.::         ||:.||.|:|||.|.:.
  Fly   848 GEMARLVCSASGDPTPEIALQKFGGSEFPAATERRLQVIREENAFLITNAKPSDSGIYTCTALSA 912

  Fly   379 GGKDSVHISVVV-QKDMERISLIDSNFFAIVCLIAMGFLSMSILFSLVTCLI-------FKRFKQ 435
            .|:..|:.::|| .|....|.|:...       :.:|          .||::       ...|:.
  Fly   913 AGEIKVNATLVVNDKPQPSIPLVHQE-------VVVG----------RTCVLQCLSETANADFEL 960

  Fly   436 FHPGQHTYLQPTSLPVQSPGSEEATAISALSSGVIRESK-IVLDPLSAINE----PSNKNYTLFK 495
            .||.:..:                           :|:| |.:.|.:...:    .:||...:..
  Fly   961 EHPHREWF---------------------------KENKPIHISPTAPDGDRYYFSNNKELLVIL 998

  Fly   496 TSNSNGSEYMHTRNYKDVRLNSNTYT---------ENLDNQAE---------------------S 530
            .:.||.:.:...    ::..||.|:|         |||:....                     :
  Fly   999 NAQSNDAGHFRC----EITDNSRTFTLQSELVVVKENLNWVVLLVGIITVTVICVVVDCCIIWCT 1059

  Fly   531 ISSRNRELYSNIAGDREKEELKQKDELD-------KDSRQSSLQSTGCSRKK-----------GQ 577
            :..:.::|..::|.:|...:|:.:...|       .:.|:.::.||..|.::           .|
  Fly  1060 LRYQKKKLRMSLAAERHSTQLRPRSLADLGCSYDEANHRRLTVMSTPPSEQRCLEQGLTLSYLRQ 1124

  Fly   578 ID-ELQPDLLPST-----QPTALKNINETFG---PSAK-----KAEVNPRSKYNTNVQKYLKEKY 628
            .| |.|.|.|.|.     ...|:|...:.|.   ||.|     :.|......|..|...|:|..|
  Fly  1125 TDLEAQQDHLSSKDSGTGSDAAVKRTLDDFEVAMPSHKHHTDDEEEEEVEEVYEENEPPYIKHTY 1189

  Fly   629 GSVRIKNISTKEP 641
                  .::..||
  Fly  1190 ------EVNYAEP 1196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_001260435.1 leucine-rich repeat 75..99 CDD:275380 6/23 (26%)
LRR_8 99..158 CDD:290566 22/66 (33%)
leucine-rich repeat 100..123 CDD:275380 9/30 (30%)
leucine-rich repeat 124..147 CDD:275380 10/22 (45%)
LRR_8 146..206 CDD:290566 20/88 (23%)
leucine-rich repeat 148..171 CDD:275380 6/22 (27%)
leucine-rich repeat 172..195 CDD:275380 10/51 (20%)
leucine-rich repeat 196..219 CDD:275380 6/22 (27%)
TPKR_C2 228..277 CDD:301599 14/60 (23%)
IG_like 294..390 CDD:214653 40/191 (21%)
Ig 296..387 CDD:143165 39/186 (21%)
lbkNP_611091.2 LRR_RI <275..446 CDD:238064 8/24 (33%)
leucine-rich repeat 293..316 CDD:275380
LRR_8 316..373 CDD:290566
leucine-rich repeat 317..338 CDD:275380
leucine-rich repeat 339..362 CDD:275380
leucine-rich repeat 363..386 CDD:275380
LRR_8 386..445 CDD:290566 8/23 (35%)
leucine-rich repeat 387..410 CDD:275380
leucine-rich repeat 411..434 CDD:275380 4/12 (33%)
leucine-rich repeat 435..457 CDD:275380 6/21 (29%)
LRR_8 457..516 CDD:290566 19/73 (26%)
leucine-rich repeat 458..481 CDD:275380 7/30 (23%)
leucine-rich repeat 482..505 CDD:275380 8/27 (30%)
LRR_RI <498..669 CDD:238064 47/180 (26%)
LRR_8 504..564 CDD:290566 20/64 (31%)
leucine-rich repeat 506..529 CDD:275380 5/24 (21%)
leucine-rich repeat 530..553 CDD:275380 11/25 (44%)
leucine-rich repeat 554..577 CDD:275380 6/22 (27%)
LRR_8 576..641 CDD:290566 14/64 (22%)
leucine-rich repeat 578..604 CDD:275380 5/25 (20%)
leucine-rich repeat 607..630 CDD:275380 5/22 (23%)
leucine-rich repeat 631..652 CDD:275380 6/20 (30%)
LRRCT 665..712 CDD:214507 12/48 (25%)
IG 734..823 CDD:214652 16/89 (18%)
Ig 735..823 CDD:143165 15/88 (17%)
I-set 834..924 CDD:254352 20/89 (22%)
Ig 851..924 CDD:299845 19/72 (26%)
IG 936..1027 CDD:214652 18/138 (13%)
Ig 961..1020 CDD:143165 13/89 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.