DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and sli

DIOPT Version :9

Sequence 1:NP_001260435.1 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001261017.1 Gene:sli / 36746 FlyBaseID:FBgn0264089 Length:2157 Species:Drosophila melanogaster


Alignment Length:644 Identity:144/644 - (22%)
Similarity:246/644 - (38%) Gaps:132/644 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CHCKWNSGKKTADCRNLSLSGVPEYLSPEVQVLDLSHNHIFYLEENAFLTTHLQNLQKLLIRNGT 109
            |.|   :| ...||.:..|:.||..:|.:|:.|:|..|::..:.|..|  ..|..|:.|.:.:..
  Fly    77 CSC---TG-LNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDF--QRLTKLRMLQLTDNQ 135

  Fly   110 LKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSKVRAIFLNGNLLQALRHGVFRNLKYLHK 174
            :..:.:.||..|..|..|.|:||.|..:..|.....:.:..:.::.|::..:...||:..:.|..
  Fly   136 IHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRS 200

  Fly   175 IELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLRVESFQDLTKLTALSLVENPWNCTCDLQMF 239
            ::|..|::..:|..||.|:..|..:.|:||.||.|....|..|.:|.||.|.:||:.|.|.|...
  Fly   201 LQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWL 265

  Fly   240 RDFVIGMNLYTPPTSCHYPLQLRGRLWIEDQPEAFACKPKIVYPTLSTSINTSKENVTLICRVHG 304
            ..|:.......|.|.|..|.||:|:...:...:.|.|             :...|:..:.|....
  Fly   266 SRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKC-------------SGLTEHAPMECGAEN 317

  Fly   305 S-PNTVIAWDYTNQVYESRSKPVKSLQKQRIYIELLREDESKIRKFGHDVFVSRLTIVNARKSDE 368
            | |:.....|   .:.:.|.|.:.|:.      ..|.:|.:::|.  ...|::.|.         
  Fly   318 SCPHPCRCAD---GIVDCREKSLTSVP------VTLPDDTTELRL--EQNFITELP--------- 362

  Fly   369 GVYTCLAENPGGKDSVHISVVVQKDMERISLIDSNFFAIVCLIAMGFLSMSILFSLVTCLIF-KR 432
                     |....|.       :.:.||.|.::|...|      ...::|.|..|.|.::: .:
  Fly   363 ---------PKSFSSF-------RRLRRIDLSNNNISRI------AHDALSGLKQLTTLVLYGNK 405

  Fly   433 FKQFHPGQHTYLQPTSLPVQSPGSEEATAISALSSGVIRESKIVLDPLSAINEPSNKNYTLFKTS 497
            .|....|....|....|.:.:     |..||.:.....|:    |..||.::...|...:|    
  Fly   406 IKDLPSGVFKGLGSLQLLLLN-----ANEISCIRKDAFRD----LHSLSLLSLYDNNIQSL---- 457

  Fly   498 NSNGSEYMHTRNYKDVRLNSNTY-----------------TENLDNQAESISSRNRELYSNIAGD 545
             :||: :...::.|.|.|..|.:                 .|....:.||....:|....::..:
  Fly   458 -ANGT-FDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREE 520

  Fly   546 REK---EELKQKDELDKDSRQSSLQSTGCSRKKGQID-------ELQPDLLPSTQPTALKNINE- 599
            :.|   :||:.|  |..:.|..|.....|..:...:|       |:..| :|......|.|.|| 
  Fly   521 KFKCSWDELRMK--LSGECRMDSDCPAMCHCEGTTVDCTGRGLKEIPRD-IPLHTTELLLNDNEL 582

  Fly   600 -------TFG--PSAKKAEVNPRSKYN--TNVQ-------KYLKE-KYGSVRIKNISTK 639
                   .||  |...|.|:    |.|  |.::       .:::| :.|..:||.||.|
  Fly   583 GRISSDGLFGRLPHLVKLEL----KRNQLTGIEPNAFEGASHIQELQLGENKIKEISNK 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_001260435.1 leucine-rich repeat 75..99 CDD:275380 6/23 (26%)
LRR_8 99..158 CDD:290566 13/58 (22%)
leucine-rich repeat 100..123 CDD:275380 5/22 (23%)
leucine-rich repeat 124..147 CDD:275380 7/22 (32%)
LRR_8 146..206 CDD:290566 14/59 (24%)
leucine-rich repeat 148..171 CDD:275380 3/22 (14%)
leucine-rich repeat 172..195 CDD:275380 7/22 (32%)
leucine-rich repeat 196..219 CDD:275380 9/22 (41%)
TPKR_C2 228..277 CDD:301599 14/48 (29%)
IG_like 294..390 CDD:214653 15/96 (16%)
Ig 296..387 CDD:143165 14/91 (15%)
sliNP_001261017.1 LRRNT 73..103 CDD:214470 9/29 (31%)
leucine-rich repeat 83..104 CDD:275380 7/20 (35%)
LRR_8 102..160 CDD:290566 17/59 (29%)
leucine-rich repeat 105..125 CDD:275380 6/21 (29%)
LRR_RI <119..259 CDD:238064 39/141 (28%)
leucine-rich repeat 126..149 CDD:275380 5/22 (23%)
LRR_8 149..208 CDD:290566 13/58 (22%)
leucine-rich repeat 150..173 CDD:275380 7/22 (32%)
leucine-rich repeat 174..197 CDD:275380 3/22 (14%)
LRR_8 197..256 CDD:290566 21/58 (36%)
leucine-rich repeat 198..221 CDD:275380 7/22 (32%)
leucine-rich repeat 222..245 CDD:275380 9/22 (41%)
leucine-rich repeat 246..371 CDD:275380 34/173 (20%)
LRRCT 254..303 CDD:214507 15/61 (25%)
LRRNT 319..350 CDD:214470 7/39 (18%)
LRR_8 349..406 CDD:290566 14/89 (16%)
LRR_4 371..411 CDD:289563 10/45 (22%)
leucine-rich repeat 372..395 CDD:275380 7/28 (25%)
leucine-rich repeat 396..415 CDD:275380 4/18 (22%)
leucine-rich repeat 420..443 CDD:275380 6/31 (19%)
leucine-rich repeat 444..465 CDD:275380 6/26 (23%)
leucine-rich repeat 468..480 CDD:275378 4/11 (36%)
LRRCT 476..525 CDD:214507 6/48 (13%)
leucine-rich repeat 484..545 CDD:275380 11/62 (18%)
LRRNT 542..574 CDD:214470 5/32 (16%)
leucine-rich repeat 552..570 CDD:275380 3/18 (17%)
leucine-rich repeat 572..596 CDD:275380 6/23 (26%)
LRR_RI <574..>678 CDD:238064 19/68 (28%)
LRR_8 595..655 CDD:290566 13/47 (28%)
leucine-rich repeat 597..620 CDD:275380 5/26 (19%)
leucine-rich repeat 621..644 CDD:275380 7/17 (41%)
leucine-rich repeat 645..668 CDD:275380
leucine-rich repeat 669..756 CDD:275380
LRRCT 677..726 CDD:214507
LRRNT 739..770 CDD:214470
leucine-rich repeat 757..791 CDD:275380
LRR_4 770..807 CDD:289563
LRR_8 790..850 CDD:290566
LRR_4 791..830 CDD:289563
leucine-rich repeat 792..815 CDD:275380
LRR_4 814..863 CDD:289563
leucine-rich repeat 816..839 CDD:275380
leucine-rich repeat 840..861 CDD:275380
LRRCT 872..920 CDD:214507
EGF 935..966 CDD:278437
EGF_CA 971..1007 CDD:238011
EGF_CA 1009..1045 CDD:238011
EGF_CA 1055..1086 CDD:238011
EGF_CA 1088..1124 CDD:238011
Laminin_G_1 1204..1335 CDD:278483
CT 1435..1504 CDD:214482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443106
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.