DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and ISLR

DIOPT Version :10

Sequence 1:NP_609615.2 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_005536.1 Gene:ISLR / 3671 HGNCID:6133 Length:428 Species:Homo sapiens


Alignment Length:371 Identity:90/371 - (24%)
Similarity:140/371 - (37%) Gaps:74/371 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CHCKWNSGKKTADCRNLSLSGVPEYLSPEVQVLDLSHNHIFYLEENAFLTTHLQNLQKLLIRNGT 109
            |.|....|.:.|||....|..||......|..|.||.|.:..|.|.||....|  ||.|.:.:..
Human    23 CDCGEKYGFQIADCAYRDLESVPPGFPANVTTLSLSANRLPGLPEGAFREVPL--LQSLWLAHNE 85

  Fly   110 LKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSKVRAIFLNGNLLQALRHGVFRNLKYLHK 174
            ::.:...:...|..|..||||:||:.|...:....||.::.:.::.|.|..:....||:|:.|..
Human    86 IRTVAAGALASLSHLKSLDLSHNLISDFAWSDLHNLSALQLLKMDSNELTFIPRDAFRSLRALRS 150

  Fly   175 IELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLRVESFQDLTKLTALSLVENPWNCTCDLQMF 239
            ::|..|||.:                        |...:|..||.|:.|.:.|||::|||.:...
Human   151 LQLNHNRLHT------------------------LAEGTFTPLTALSHLQINENPFDCTCGIVWL 191

  Fly   240 RDFVIGMNLYTPP---TSCHYPLQLRGRLWIEDQPEAFACKPKIVYPTLSTSINTSKEN------ 295
            :.:.:...:..|.   .:|..|..|:|.......|  ..|..    |::..|...|::.      
Human   192 KTWALTTAVSIPEQDNIACTSPHVLKGTPLSRLPP--LPCSA----PSVQLSYQPSQDGAELRPG 250

  Fly   296 --VTLICRVHGSPNTVIAW--DYTNQVYESRS------------KPVKSLQKQRIYIELLREDES 344
              :.|.|.|.|.|...:.|  ...:.:.|..|            .||.|.|             .
Human   251 FVLALHCDVDGQPAPQLHWHIQIPSGIVEITSPNVGTDGRALPGTPVASSQ-------------P 302

  Fly   345 KIRKFGHDVFVSRLTIVNARKSDEGVYTCLAENPGGKDSVHISVVV 390
            :.:.|.:    ..|.|.:..|.:||.|:|||.|..|.....:.|.:
Human   303 RFQAFAN----GSLLIPDFGKLEEGTYSCLATNELGSAESSVDVAL 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_609615.2 LRR 59..>228 CDD:443914 43/168 (26%)
leucine-rich repeat 75..99 CDD:275380 9/23 (39%)
LRR_8 98..158 CDD:404697 15/59 (25%)
leucine-rich repeat 100..123 CDD:275380 4/22 (18%)
leucine-rich repeat 124..147 CDD:275380 9/22 (41%)
leucine-rich repeat 148..171 CDD:275380 5/22 (23%)
leucine-rich repeat 172..195 CDD:275380 5/22 (23%)
leucine-rich repeat 196..219 CDD:275380 3/22 (14%)
LRRCT 228..277 CDD:214507 11/51 (22%)
IG_like 294..390 CDD:214653 25/117 (21%)
Ig strand B 296..300 CDD:409353 1/3 (33%)
Ig strand C 309..323 CDD:409353 2/15 (13%)
Ig strand E 356..360 CDD:409353 1/3 (33%)
Ig strand F 370..375 CDD:409353 2/4 (50%)
Ig strand G 383..386 CDD:409353 0/2 (0%)
ISLRNP_005536.1 leucine-rich repeat 32..51 CDD:275380 6/18 (33%)
LRR <50..>182 CDD:443914 42/157 (27%)
LRR 1 51..72 9/20 (45%)
leucine-rich repeat 52..75 CDD:275380 9/22 (41%)
LRR 2 75..96 4/22 (18%)
leucine-rich repeat 76..99 CDD:275380 4/22 (18%)
LRR 3 99..122 8/22 (36%)
leucine-rich repeat 100..123 CDD:275380 9/22 (41%)
LRR 4 123..144 3/20 (15%)
leucine-rich repeat 124..147 CDD:275380 5/22 (23%)
LRR 5 147..168 7/44 (16%)
leucine-rich repeat 148..171 CDD:275380 8/46 (17%)
PCC 153..>227 CDD:188093 22/99 (22%)
Ig 239..340 CDD:472250 25/117 (21%)
Ig strand B 253..257 CDD:409546 1/3 (33%)
Ig strand C 266..270 CDD:409546 0/3 (0%)
Ig strand E 310..314 CDD:409546 1/3 (33%)
Ig strand F 324..329 CDD:409546 2/4 (50%)

Return to query results.
Submit another query.