DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and Lrrc24

DIOPT Version :9

Sequence 1:NP_001260435.1 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001129368.1 Gene:Lrrc24 / 362945 RGDID:1308720 Length:521 Species:Rattus norvegicus


Alignment Length:365 Identity:99/365 - (27%)
Similarity:163/365 - (44%) Gaps:36/365 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CHCKWNSGKKTADCRNLSLSGVPEYLSPEVQVLDLSHNHIFYLEENAFLTTHLQNLQKLLIRNGT 109
            |.|.    ..|.:|..|.|..||..:.|..|.|.|..|.|.:||:.|.  ..|..|:.|.:.|.|
  Rat    35 CRCY----SATVECGALRLRVVPPGIPPGTQTLFLQDNSIAHLEQGAL--APLAALRHLYLHNNT 93

  Fly   110 LKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSKVRAIFLNGNLLQALRHGVFRNLKYLHK 174
            |:.|...:|.....|:||.|:.|.|..|....|..|.::|.::|.||.|..|....|.:|..|.:
  Rat    94 LRALESGAFRAQPRLLELALTGNRLRGLRGGAFVGLVQLRVLYLAGNQLAKLLDFTFLHLPRLQE 158

  Fly   175 IELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLRVESFQDLTKLTALSLVENPWNCTCDLQMF 239
            :.|:.|.:..::.:|..|:..|:.:.|..|:|..:..|:.|.|:.|..|.|.||||.|.|.|...
  Rat   159 LHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISKEALQPLSSLQVLRLTENPWRCDCALHWL 223

  Fly   240 RDFVI--GMNLYT---PPTSCHYPLQLRGRLWIEDQPEAFACKPKIVY---PTLSTSINTSKENV 296
            ..::.  |..|.:   ...:|..|.:|..:..:|....:..|.|..|.   |.|:.::.   |::
  Rat   224 GSWIKEGGRRLLSSRDKKITCAEPPRLALQSLLEVSGGSLICIPPSVNAEPPELTANLG---EDL 285

  Fly   297 TLICRVHGSPNTVIAWDYTNQVYESR-SKPVKSLQKQ----RIYIELLREDESKIRKFGHDVFVS 356
            .:.|:..|.|..::.|   .::.:.| .||...:|.:    .:.....|:..|.:      :|::
  Rat   286 QVACQASGYPQPLVVW---RKMLQPRDGKPQAQVQLEGGAPGLGGHATRDTGSGM------LFLT 341

  Fly   357 RLTIVNARKSDEGVYTCLAENPGGKDSVHISVVVQKDMER 396
            .:|:.:|     |.|.|.|.|.|||..|...::|....::
  Rat   342 NITLAHA-----GKYECEATNAGGKARVLFHLLVNASRQQ 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_001260435.1 leucine-rich repeat 75..99 CDD:275380 9/23 (39%)
LRR_8 99..158 CDD:290566 20/58 (34%)
leucine-rich repeat 100..123 CDD:275380 7/22 (32%)
leucine-rich repeat 124..147 CDD:275380 9/22 (41%)
LRR_8 146..206 CDD:290566 16/59 (27%)
leucine-rich repeat 148..171 CDD:275380 8/22 (36%)
leucine-rich repeat 172..195 CDD:275380 5/22 (23%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
TPKR_C2 228..277 CDD:301599 12/53 (23%)
IG_like 294..390 CDD:214653 23/100 (23%)
Ig 296..387 CDD:143165 22/95 (23%)
Lrrc24NP_001129368.1 leucine-rich repeat 61..83 CDD:275380 9/23 (39%)
PPP1R42 63..>212 CDD:411060 47/150 (31%)
LRR_8 84..142 CDD:404697 20/57 (35%)
leucine-rich repeat 84..107 CDD:275380 7/22 (32%)
leucine-rich repeat 108..131 CDD:275380 9/22 (41%)
leucine-rich repeat 132..155 CDD:275380 8/22 (36%)
leucine-rich repeat 156..179 CDD:275380 5/22 (23%)
leucine-rich repeat 180..203 CDD:275380 7/22 (32%)
PCC 188..>259 CDD:188093 21/70 (30%)
Ig_3 267..357 CDD:404760 22/106 (21%)
Ig strand A 267..271 CDD:409353 1/3 (33%)
Ig strand A' 276..280 CDD:409353 1/3 (33%)
Ig strand B 283..292 CDD:409353 2/8 (25%)
Ig strand C 298..304 CDD:409353 1/8 (13%)
Ig strand D 330..333 CDD:409353 1/2 (50%)
Ig strand E 336..342 CDD:409353 1/11 (9%)
Ig strand F 349..357 CDD:409353 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4399
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45224
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24366
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
66.020

Return to query results.
Submit another query.