DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and CG14762

DIOPT Version :9

Sequence 1:NP_001260435.1 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster


Alignment Length:354 Identity:77/354 - (21%)
Similarity:154/354 - (43%) Gaps:38/354 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 KTADCRNLSLS-GVPEYLSPEVQVLDLSHNHIFYLEENAFLTTHLQNLQKLLIRNGTLKYLNQRS 117
            :|.|..:::.| |..:..||.:..|.|.||::..|:...||..   :::.|.|.|.:|..:.:.:
  Fly    62 ETTDLAHITKSMGTLKGKSPIIFYLKLRHNNLPKLQGFVFLAL---DIRHLTIHNSSLAAIEENA 123

  Fly   118 FTQLQI-LIELDLSNNLLVDLLPNVFDCLSKVRAIFLNGNLLQALRHGVFRNLKYLHKIELKRNR 181
            .:.|.. |.:||:|.|.:..:.......|..:..:.||.|.:..:.:..|..|:.|..:.|..|:
  Fly   124 LSSLGAGLTQLDVSLNQMKTVPSQALQHLFHLLILNLNHNKITVIHNNAFEGLETLEILTLYENK 188

  Fly   182 LVSIDAKAFVGV-PLLSQIYLDNNELTKLRVESFQDLTKLTALSLVENPWNCTCD-----LQMFR 240
            :..||.:||.|: ..:.::.|..|:||.:..::...|:.|..|.:.||......:     ||...
  Fly   189 ITQIDPEAFRGLEDHIKRLNLGGNDLTNIPQKALSILSTLKKLEIQENKIRTISEGDFEGLQSLD 253

  Fly   241 DFVIGMNLYTP-PTSCHYPLQLRGRLWIEDQPEAFACKPKIVYPTLSTSINTSKENVTLICRVHG 304
            ..::..|:.|. |.:....|.|...|.:|....:...|         .:....:||:..: |:. 
  Fly   254 SLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDK---------DAFKGLEENLQYL-RLG- 307

  Fly   305 SPNTVIAWDYTNQVYESRSKPVKSLQKQRIYIELLREDESKIRKFGHDVFVSRLTIVNARKSDEG 369
                      .||::...|:.::.|.:.| :::|...:.:.:.:.....|...||.:|.:|:|..
  Fly   308 ----------DNQIHTIPSEALRPLHRLR-HLDLRNNNINVLAEDAFTGFGDSLTFLNLQKNDIK 361

  Fly   370 VY-TCLAENPGGKDSVHISVVVQKDMERI 397
            |. :.|.||....:::::.   ...::||
  Fly   362 VLPSLLFENLNSLETLNLQ---NNKLQRI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_001260435.1 leucine-rich repeat 75..99 CDD:275380 7/23 (30%)
LRR_8 99..158 CDD:290566 14/59 (24%)
leucine-rich repeat 100..123 CDD:275380 5/22 (23%)
leucine-rich repeat 124..147 CDD:275380 6/22 (27%)
LRR_8 146..206 CDD:290566 15/60 (25%)
leucine-rich repeat 148..171 CDD:275380 5/22 (23%)
leucine-rich repeat 172..195 CDD:275380 8/23 (35%)
leucine-rich repeat 196..219 CDD:275380 5/22 (23%)
TPKR_C2 228..277 CDD:301599 10/54 (19%)
IG_like 294..390 CDD:214653 19/96 (20%)
Ig 296..387 CDD:143165 17/91 (19%)
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 7/22 (32%)
LRR_RI 93..384 CDD:238064 65/318 (20%)
leucine-rich repeat 107..129 CDD:275380 5/21 (24%)
leucine-rich repeat 131..154 CDD:275380 6/22 (27%)
LRR_8 154..214 CDD:290566 15/59 (25%)
leucine-rich repeat 155..178 CDD:275380 5/22 (23%)
leucine-rich repeat 179..203 CDD:275380 8/23 (35%)
leucine-rich repeat 204..227 CDD:275380 5/22 (23%)
LRR_8 226..286 CDD:290566 13/59 (22%)
leucine-rich repeat 228..251 CDD:275380 5/22 (23%)
leucine-rich repeat 252..275 CDD:275380 4/22 (18%)
LRR_8 276..335 CDD:290566 12/80 (15%)
leucine-rich repeat 276..300 CDD:275380 3/32 (9%)
leucine-rich repeat 301..324 CDD:275380 5/34 (15%)
leucine-rich repeat 325..349 CDD:275380 3/24 (13%)
LRR_8 349..409 CDD:290566 11/42 (26%)
leucine-rich repeat 350..373 CDD:275380 9/22 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445077
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.