DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and rdo

DIOPT Version :10

Sequence 1:NP_609615.2 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster


Alignment Length:579 Identity:117/579 - (20%)
Similarity:200/579 - (34%) Gaps:211/579 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VQVLDLSHNHIFYLEENAF----------------------LTTHLQNLQKLLIRNGTLKYLNQR 116
            :::||||.|:|..:.||.|                      ...||.:|::|.:.:.::..|.||
  Fly   108 LRILDLSKNNITNITENNFRGQDNLLELDLSKNKVLRMASSTFRHLTDLRRLNLADNSIVELVQR 172

  Fly   117 SFTQLQILIELDLSNNLLVDLLPNVF------------DC------------------------- 144
            :|..|..|..||||.|.|.||.|:||            :|                         
  Fly   173 NFFMLSRLKYLDLSGNPLQDLQPDVFRDVPELKVLKCRNCQLKKINPQMYNLLPLLSELDLGRNE 237

  Fly   145 -----------LSKVRAIFLNGNLLQALRHGVFRNLKYLHKIELKRNRLVSIDAKAFVGVPLLSQ 198
                       :.::..:.|:||.|..:...:||..|.|:.::|..|||..:...:|:.:..|:.
  Fly   238 FKFLDKDEFRDVKRLTKVLLDGNQLSVVVDQLFRMQKSLNHLDLSYNRLAKVPNDSFLQLTNLTF 302

  Fly   199 IYLDNNELTKLRVESFQDLTKLTALSLVENPWNCTCDLQMFRD---------FVIGMNLY----- 249
            :.|..|:|.:|..:|.:.|:.|..|::   ..|...||:..|:         |:....|:     
  Fly   303 LDLSYNKLVRLEPQSIRSLSNLLTLNI---SGNVLMDLREMRETFEPLIYYFFLTCSKLFFQLIP 364

  Fly   250 -----------TPPTSCHYPL-QLRGRLWIEDQPEAFACKPKIVYPTLS-TSINTSKENVTLICR 301
                       |.|....:|. |||                   |..:| .|:|.:...|...||
  Fly   365 QLTHLAIADMGTMPVGLLHPFKQLR-------------------YLNISGNSLNNTALEVIDPCR 410

  Fly   302 -----------VHG-SPNTVIAWDYTNQVYESRSKPVKSLQKQRI--------------YIELLR 340
                       :|| |.:||:.              ::.::..|:              .|.::|
  Fly   411 ELEFLDLSRNQLHGISEDTVLR--------------IQGIRNVRLDNNPLICDECHMGKLINVVR 461

  Fly   341 EDESK--------IRKFGHDVFVSRLTIVNARKSDEGVYTCL---AENPGGKDSVHISVVVQKDM 394
            :.:.|        :.|......::.|.|       .|::|||   .:......|...:.:....:
  Fly   462 QLQWKWDTYPICFLPKSLRGAEINNLDI-------NGLHTCLTFITDEEQNAASTSYNFLEHGGL 519

  Fly   395 ERISLIDSNFFAIVCLIAMGFLSMSILFSLVTCLIFKRFKQFHPGQHTYLQPTSLPVQSPGSE-- 457
            ..::::....|.::.:         |:.|||.|....|.:.:....|.           .|||  
  Fly   520 NTLAILGGIIFVLIAV---------IILSLVACFSKNRARYYTREDHL-----------NGSESK 564

  Fly   458 ------EATAISALSSGVIRESKIVL----DPLSAINEPSNKNYTLFKTSNSNGSEYMH 506
                  |||.|:.|.:|....:...|    .| :|.|.|......| ..|.:|||..:|
  Fly   565 CLEKNLEATTITTLGNGSSPTTTTTLTLATSP-AAPNGPKTNGQGL-SLSPANGSTPVH 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_609615.2 LRR 59..>228 CDD:443914 53/223 (24%)
leucine-rich repeat 75..99 CDD:275380 11/45 (24%)
LRR_8 98..158 CDD:404697 23/107 (21%)
leucine-rich repeat 100..123 CDD:275380 7/22 (32%)
leucine-rich repeat 124..147 CDD:275380 13/70 (19%)
leucine-rich repeat 148..171 CDD:275380 6/22 (27%)
leucine-rich repeat 172..195 CDD:275380 6/22 (27%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
LRRCT 228..277 CDD:214507 12/74 (16%)
IG_like 294..390 CDD:214653 20/132 (15%)
Ig strand B 296..300 CDD:409353 1/3 (33%)
Ig strand C 309..323 CDD:409353 1/13 (8%)
Ig strand E 356..360 CDD:409353 1/3 (33%)
Ig strand F 370..375 CDD:409353 3/7 (43%)
Ig strand G 383..386 CDD:409353 1/2 (50%)
rdoNP_001286024.1 LRR 69..>446 CDD:443914 78/373 (21%)
leucine-rich repeat 84..107 CDD:275380
leucine-rich repeat 108..131 CDD:275380 9/22 (41%)
leucine-rich repeat 132..155 CDD:275380 2/22 (9%)
leucine-rich repeat 156..179 CDD:275380 7/22 (32%)
leucine-rich repeat 180..203 CDD:275380 12/22 (55%)
leucine-rich repeat 204..251 CDD:275380 1/46 (2%)
leucine-rich repeat 252..275 CDD:275380 6/22 (27%)
leucine-rich repeat 276..299 CDD:275380 6/22 (27%)
leucine-rich repeat 300..323 CDD:275380 7/22 (32%)
leucine-rich repeat 388..411 CDD:275380 8/41 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.