DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and CG5096

DIOPT Version :10

Sequence 1:NP_609615.2 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster


Alignment Length:364 Identity:82/364 - (22%)
Similarity:132/364 - (36%) Gaps:146/364 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LLDCGNCHCKWNSGK------------KTADCRNLSLSGVP---------EYLS----------- 71
            ||||......|.|.:            ||.:..:.:|:.||         .||:           
  Fly    58 LLDCSEKLQDWLSAEDWEDLTNGNVVFKTINLEHNNLTSVPILPKYDVENLYLANNQIDSISVGA 122

  Fly    72 ----PEVQVLDLSHNHI-------------FYLEE--------------------NAFLTTHLQN 99
                .|:..||||||.:             |.:::                    :|.|..|:.:
  Fly   123 FQNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQDFESLENLKTLNLGYNDLHSLDADLFEHIPH 187

  Fly   100 LQKLLIRNGTLKYLNQRSFTQ---LQILIELDLSNNLLVDLLP-----------------NVFDC 144
            :::|::.:.:...::|.|.|.   ||.|..||:| .:.:|.||                 |:|:.
  Fly   188 IEELVLCSNSFHVIDQLSETAISGLQSLKILDVS-YMEIDDLPDTILHGPRDLEIFIAAGNLFNQ 251

  Fly   145 LSK-------VRAIFLNGNLLQ------------ALRH--------------GVFRNLKYLHKIE 176
            |.|       :.::.||.|.::            .|.|              |.|..|:.|.::.
  Fly   252 LPKALKYATNLTSLVLNENPIENLIGDNVFPPLTKLTHLSMTFMSKLYKIGPGAFSELQSLTELI 316

  Fly   177 LKRNRLVS-IDAKA---------FVGVPLLSQIYLDNNELTKLRVESFQDLTKLTALSLVENPWN 231
            |..|:|:: ||.:|         ::..|.|.::||:|..::.|..|......||.||.|..||||
  Fly   317 LSDNKLLNEIDEEALSKNVTGGQYLDYPPLEKVYLNNCNVSTLPKELLVRWDKLKALDLRFNPWN 381

  Fly   232 CTCDLQMFRDFVIG-----MNLYTP----PTSCHYPLQL 261
            |    ....||:|.     :|..||    ...|..|.:|
  Fly   382 C----DESNDFLINVLIDRINKTTPVLAKDVKCGGPNKL 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_609615.2 LRR 59..>228 CDD:443914 60/288 (21%)
leucine-rich repeat 75..99 CDD:275380 10/56 (18%)
LRR_8 98..158 CDD:404697 20/86 (23%)
leucine-rich repeat 100..123 CDD:275380 5/25 (20%)
leucine-rich repeat 124..147 CDD:275380 10/39 (26%)
leucine-rich repeat 148..171 CDD:275380 8/48 (17%)
leucine-rich repeat 172..195 CDD:275380 7/32 (22%)
leucine-rich repeat 196..219 CDD:275380 6/22 (27%)
LRRCT 228..277 CDD:214507 14/43 (33%)
IG_like 294..390 CDD:214653
Ig strand B 296..300 CDD:409353
Ig strand C 309..323 CDD:409353
Ig strand E 356..360 CDD:409353
Ig strand F 370..375 CDD:409353
Ig strand G 383..386 CDD:409353
CG5096NP_723576.1 LRR 54..>322 CDD:443914 52/264 (20%)
leucine-rich repeat 85..104 CDD:275380 5/18 (28%)
leucine-rich repeat 105..128 CDD:275380 2/22 (9%)
leucine-rich repeat 129..163 CDD:275380 7/33 (21%)
leucine-rich repeat 164..187 CDD:275380 3/22 (14%)
leucine-rich repeat 188..214 CDD:275380 5/25 (20%)
leucine-rich repeat 215..238 CDD:275380 7/23 (30%)
leucine-rich repeat 239..261 CDD:275380 4/21 (19%)
leucine-rich repeat 262..286 CDD:275380 3/23 (13%)
leucine-rich repeat 287..311 CDD:275380 5/23 (22%)
leucine-rich repeat 346..369 CDD:275380 6/22 (27%)
leucine-rich repeat 370..388 CDD:275380 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.