DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and Lrrc55

DIOPT Version :9

Sequence 1:NP_001260435.1 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001381943.1 Gene:Lrrc55 / 311171 RGDID:1561726 Length:311 Species:Rattus norvegicus


Alignment Length:270 Identity:69/270 - (25%)
Similarity:105/270 - (38%) Gaps:44/270 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HLSLFLFKIYCLALIFRS---ASADWLLDCGNCHCKWNSGKKTADCRNLSLSGVPEYLSPEVQVL 77
            |.:|.|......|.:..|   ||...|..|.|         :..||.|..|..||..|..:.:.|
  Rat    28 HSALLLVFFLLAAGVMHSDAGASCPVLCTCRN---------QVVDCSNQRLFSVPPDLPMDTRNL 83

  Fly    78 DLSHNHIFYLEENAFLTTHLQNLQKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVF 142
            .|:||.|..:.. .:||.:::                         |..|||.||.|::|.|.:|
  Rat    84 SLAHNRIAAVPP-GYLTCYME-------------------------LRVLDLRNNSLMELPPGLF 122

  Fly   143 DCLSKVRAIFLNGNLLQALRHGVFRNLKYLHKIELKRNR-LVSIDAKAFVGVPLLSQIYLDNNEL 206
            ....::..:.|:.|.|..:...:||....|..|:|..|. |..:..:||.|:..|..:.|....|
  Rat   123 LHAKRLAHLDLSYNNLSHVPADMFREAHGLVHIDLSHNPWLRRVHPQAFQGLVHLRDLDLSYGGL 187

  Fly   207 TKLRVESFQDLTKLTALSLVENPWNCTCD----LQMFRDFVIGMNLYTPPTSCHYPLQLRGRLWI 267
            ..|.:|:.:.|..|..|.:..|||.|.|.    |:..|:.:......:....|..|.::.|....
  Rat   188 AFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQLAECRGPPEVEGAPLF 252

  Fly   268 EDQPEAF-AC 276
            ....|:| ||
  Rat   253 SLTEESFKAC 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_001260435.1 leucine-rich repeat 75..99 CDD:275380 7/23 (30%)
LRR_8 99..158 CDD:290566 12/58 (21%)
leucine-rich repeat 100..123 CDD:275380 0/22 (0%)
leucine-rich repeat 124..147 CDD:275380 10/22 (45%)
LRR_8 146..206 CDD:290566 15/60 (25%)
leucine-rich repeat 148..171 CDD:275380 5/22 (23%)
leucine-rich repeat 172..195 CDD:275380 8/23 (35%)
leucine-rich repeat 196..219 CDD:275380 6/22 (27%)
TPKR_C2 228..277 CDD:301599 14/54 (26%)
IG_like 294..390 CDD:214653
Ig 296..387 CDD:143165
Lrrc55NP_001381943.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.