DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and Lrrc4b

DIOPT Version :10

Sequence 1:NP_609615.2 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001258010.1 Gene:Lrrc4b / 308571 RGDID:1307121 Length:709 Species:Rattus norvegicus


Alignment Length:438 Identity:106/438 - (24%)
Similarity:166/438 - (37%) Gaps:122/438 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CHCKWNSGKKTADCRNLSLSGVP-------EYLSPE-----------------VQVLDLSHNHIF 85
            |.|. |...:.. |....|:.||       .||:.:                 :::|.||.|.:.
  Rat    63 CSCS-NQASRVI-CTRRELAEVPASIPVNTRYLNLQENSIQVIRTDTFKHLRHLEILQLSKNLVR 125

  Fly    86 YLEENAF---------------LTT-------HLQNLQKLLIRNGTLKYLNQRSFTQLQILIELD 128
            .:|..||               |||       :|..|::|.:||..::.:...:|.::..|..||
  Rat   126 KIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLRRLD 190

  Fly   129 LSN------------NLLVDL------------LPNVFDCLSKVRAIFLNGNLLQALRHGVFRNL 169
            |..            ..||:|            :||: ..|.::..:.|:||.|..:|.|.|:.|
  Rat   191 LGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNL-TALVRLEELELSGNRLDLIRPGSFQGL 254

  Fly   170 KYLHKIELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLRVESFQDLTKLTALSLVENPWNCTC 234
            ..|.|:.|...::.:|:..||..:..|.::.|.:|.|..|..:.|..|.:|..:.|..|||:|.|
  Rat   255 TSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFTPLHRLERVHLNHNPWHCNC 319

  Fly   235 DLQMFRDFVIGMNLY---TPPTS------CHYPLQLRGRLWIEDQPEAFAC-KPKIVYPTLSTSI 289
            |       |:.::.:   |.|::      ||.|..|:||...|.....|.| .|.||.|  .|.:
  Rat   320 D-------VLWLSWWLKETVPSNTTCCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEP--PTDL 375

  Fly   290 N-TSKENVTLICRVHGSPNTVIAWDYTNQVYESRSKPVKSLQKQRIYIELLREDESKIRKFGHDV 353
            | |......|.||. |:..|.:.|...|....:..       ..|:.|.:|           || 
  Rat   376 NVTEGMAAELKCRT-GTSMTSVNWLTPNGTLMTHG-------SYRVRISVL-----------HD- 420

  Fly   354 FVSRLTIVNARKSDEGVYTCLAENPGGKDSVHISVVVQKDMERISLID 401
              ..|...|....|.|.|||:..|..|..:...::       .:|.:|
  Rat   421 --GTLNFTNVTVQDTGQYTCMVTNSAGNTTASATL-------NVSAVD 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_609615.2 LRR 59..>228 CDD:443914 54/238 (23%)
leucine-rich repeat 75..99 CDD:275380 11/45 (24%)
LRR_8 98..158 CDD:404697 18/83 (22%)
leucine-rich repeat 100..123 CDD:275380 5/22 (23%)
leucine-rich repeat 124..147 CDD:275380 10/46 (22%)
leucine-rich repeat 148..171 CDD:275380 8/22 (36%)
leucine-rich repeat 172..195 CDD:275380 6/22 (27%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
LRRCT 228..277 CDD:214507 18/58 (31%)
IG_like 294..390 CDD:214653 21/95 (22%)
Ig strand B 296..300 CDD:409353 1/3 (33%)
Ig strand C 309..323 CDD:409353 2/13 (15%)
Ig strand E 356..360 CDD:409353 1/3 (33%)
Ig strand F 370..375 CDD:409353 3/4 (75%)
Ig strand G 383..386 CDD:409353 0/2 (0%)
Lrrc4bNP_001258010.1 LRRNT 59..92 CDD:214470 7/30 (23%)
LRR <89..>314 CDD:443914 51/225 (23%)
LRR 1 89..110 2/20 (10%)
leucine-rich repeat 90..113 CDD:275380 2/22 (9%)
LRR 2 113..134 7/20 (35%)
leucine-rich repeat 114..137 CDD:275380 7/22 (32%)
LRR 3 137..158 3/20 (15%)
leucine-rich repeat 138..161 CDD:275380 4/22 (18%)
LRR 4 161..182 5/20 (25%)
leucine-rich repeat 162..185 CDD:275380 5/22 (23%)
LRR 5 185..207 4/21 (19%)
leucine-rich repeat 186..210 CDD:275380 5/23 (22%)
LRR 6 210..231 3/21 (14%)
leucine-rich repeat 211..232 CDD:275380 4/21 (19%)
LRR 7 232..253 7/20 (35%)
leucine-rich repeat 233..256 CDD:275380 8/22 (36%)
LRR 8 256..277 6/20 (30%)
leucine-rich repeat 257..280 CDD:275380 6/22 (27%)
LRR 9 280..301 6/20 (30%)
leucine-rich repeat 281..302 CDD:275380 6/20 (30%)
LRRCT 313..363 CDD:214507 17/56 (30%)
I-set 366..455 CDD:400151 28/119 (24%)
Ig strand B 383..387 CDD:409353 1/3 (33%)
Ig strand C 395..399 CDD:409353 0/3 (0%)
Ig strand E 421..425 CDD:409353 1/3 (33%)
Ig strand F 435..440 CDD:409353 3/4 (75%)
Ig strand G 448..451 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 496..552
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.