DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and Lrfn3

DIOPT Version :10

Sequence 1:NP_609615.2 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001100972.1 Gene:Lrfn3 / 308495 RGDID:1305567 Length:626 Species:Rattus norvegicus


Alignment Length:385 Identity:88/385 - (22%)
Similarity:140/385 - (36%) Gaps:72/385 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CHCKWNSGKKTADCRNLSLSGVPEYLSPEVQVLDLSHNHIFYLEENAFLTTHLQNLQKLLIRNGT 109
            |.|:..|...:..|....|..||..|......|.|:.|.|..:.....  .::..|..|.:...|
  Rat    32 CRCQTQSLPLSVLCPGAGLLFVPPSLDRRAAELRLADNFIAAVRRRDL--ANMTGLLHLSLSRNT 94

  Fly   110 LKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSKVRAIFLNGNLLQALRHGV--------- 165
            ::::...:|..|:.|..|.|..|.|..|.......|..:|.:.|:.|.|.||..|.         
  Rat    95 IRHVAAGAFADLRALRALHLDGNRLTSLGEGQLRGLVNLRHLILSNNQLAALAAGALDDCAETLE 159

  Fly   166 -----FRNLKYL-----------HKIELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLRVESF 214
                 :.||:.|           :.:.|..|.|.|:.|.||..:..|:::.:.:|.||.:..:..
  Rat   160 DLDLSYNNLEQLPWEALGRLGNVNTLGLDHNLLASVPAGAFSRLHKLARLDMTSNRLTTIPPDPL 224

  Fly   215 QDLTKLTA-----------LSLVENPWNCTCDLQMFRDFVIGMNLYTPPTSCHYPLQLRGRLWIE 268
            .....|.|           |:...||.:|.|:|...|......:|    .:|..|..|.||.:..
  Rat   225 FSRLPLLARPRGSPASALVLAFGGNPLHCNCELVWLRRLAREDDL----EACASPPALGGRYFWA 285

  Fly   269 DQPEAFACKPKIV---YPTLSTSINTSKENVTLICRVHGSPNTVIAWDYTNQVYESRSKPVKSLQ 330
            ...|.|.|:|.:|   .|.|:.   .:.....|.||..|.|...:.|              .|.|
  Rat   286 VGEEEFVCEPPVVTHRSPPLAV---PAGRPAALRCRAVGDPEPRVRW--------------VSPQ 333

  Fly   331 KQRIYIELLREDESKIRKFGHDVFVSRLTIVNARKSDEGVYTCLAENPGGKDSVHISVVV 390
            .:      |..:.|:.|.|.:    ..|.::.....|.|.:||:|.|..|:.:..:.:.|
  Rat   334 GR------LLGNSSRARAFPN----GTLELLVTEPEDGGTFTCIAANAAGEATAAVELTV 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_609615.2 LRR 59..>228 CDD:443914 44/204 (22%)
leucine-rich repeat 75..99 CDD:275380 4/23 (17%)
LRR_8 98..158 CDD:404697 15/59 (25%)
leucine-rich repeat 100..123 CDD:275380 5/22 (23%)
leucine-rich repeat 124..147 CDD:275380 7/22 (32%)
leucine-rich repeat 148..171 CDD:275380 9/36 (25%)
leucine-rich repeat 172..195 CDD:275380 8/33 (24%)
leucine-rich repeat 196..219 CDD:275380 4/22 (18%)
LRRCT 228..277 CDD:214507 14/48 (29%)
IG_like 294..390 CDD:214653 20/95 (21%)
Ig strand B 296..300 CDD:409353 1/3 (33%)
Ig strand C 309..323 CDD:409353 1/13 (8%)
Ig strand E 356..360 CDD:409353 1/3 (33%)
Ig strand F 370..375 CDD:409353 2/4 (50%)
Ig strand G 383..386 CDD:409353 0/2 (0%)
Lrfn3NP_001100972.1 leucine-rich repeat 63..84 CDD:275380 4/22 (18%)
LRR <78..>228 CDD:443914 33/151 (22%)
LRR 1 84..105 4/20 (20%)
leucine-rich repeat 85..108 CDD:275380 5/22 (23%)
LRR 2 108..129 6/20 (30%)
leucine-rich repeat 109..132 CDD:275380 7/22 (32%)
LRR 3 132..153 7/20 (35%)
leucine-rich repeat 133..157 CDD:275380 7/23 (30%)
LRR 4 157..178 3/20 (15%)
leucine-rich repeat 158..181 CDD:275380 3/22 (14%)
LRR 5 181..202 7/20 (35%)
leucine-rich repeat 182..205 CDD:275380 7/22 (32%)
LRR 6 205..226 4/20 (20%)
leucine-rich repeat 206..230 CDD:275380 4/23 (17%)
leucine-rich repeat 242..253 CDD:275378 3/10 (30%)
LRRCT 249..>281 CDD:214507 10/35 (29%)
Ig 296..383 CDD:472250 23/113 (20%)
Ig strand B 313..317 CDD:409353 1/3 (33%)
Ig strand C 326..330 CDD:409353 1/17 (6%)
Ig strand E 349..353 CDD:409353 1/3 (33%)
Ig strand F 363..368 CDD:409353 2/4 (50%)
Ig strand G 376..379 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..423 1/2 (50%)
fn3 425..502 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.