| Sequence 1: | NP_001260435.1 | Gene: | kek4 / 34718 | FlyBaseID: | FBgn0032484 | Length: | 649 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_036927.2 | Gene: | Gp5 / 25259 | RGDID: | 2724 | Length: | 567 | Species: | Rattus norvegicus |
| Alignment Length: | 284 | Identity: | 82/284 - (28%) |
|---|---|---|---|
| Similarity: | 124/284 - (43%) | Gaps: | 39/284 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 61 LSLSG-VPEYLSPE-------VQVLDLSHNHIFYLEENAFLTTHLQNLQKLLIRNGT-LKYLNQR 116
Fly 117 SFTQLQILIELDLSNNLLVDLLP-NVFDCLSKVRAIFLNGNLLQALRHGVFRNLKYLHKIELKRN 180
Fly 181 RLVSIDAKAFVGVPLLSQIYLDNNELTKLRVESFQDLTKLTALSLVENPWNCTCDLQMFRDF--- 242
Fly 243 ---VIGMNLYTPPTSCHYPLQ---------LRGRLWIEDQPEAFACKP------KIVYPTLSTSI 289
Fly 290 NTSKENVTLICRVHGSPNTVIAWD 313 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek4 | NP_001260435.1 | leucine-rich repeat | 75..99 | CDD:275380 | 6/23 (26%) |
| LRR_8 | 99..158 | CDD:290566 | 21/60 (35%) | ||
| leucine-rich repeat | 100..123 | CDD:275380 | 9/23 (39%) | ||
| leucine-rich repeat | 124..147 | CDD:275380 | 9/23 (39%) | ||
| LRR_8 | 146..206 | CDD:290566 | 16/59 (27%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 7/22 (32%) | ||
| TPKR_C2 | 228..277 | CDD:301599 | 16/63 (25%) | ||
| IG_like | 294..390 | CDD:214653 | 6/20 (30%) | ||
| Ig | 296..387 | CDD:143165 | 6/18 (33%) | ||
| Gp5 | NP_036927.2 | LRR_8 | <64..110 | CDD:404697 | |
| LRR 1 | 75..96 | ||||
| leucine-rich repeat | 76..99 | CDD:275380 | |||
| LRR 2 | 99..120 | ||||
| leucine-rich repeat | 100..123 | CDD:275380 | |||
| PRK15370 | <103..>422 | CDD:185268 | 55/177 (31%) | ||
| LRR 3 | 123..144 | ||||
| leucine-rich repeat | 124..147 | CDD:275380 | |||
| LRR 4 | 147..168 | ||||
| leucine-rich repeat | 148..171 | CDD:275380 | |||
| LRR 5 | 171..193 | ||||
| leucine-rich repeat | 172..195 | CDD:275380 | |||
| LRR 6 | 195..216 | ||||
| leucine-rich repeat | 196..219 | CDD:275380 | |||
| LRR 7 | 219..240 | ||||
| leucine-rich repeat | 220..243 | CDD:275380 | |||
| LRR 8 | 243..264 | 7/16 (44%) | |||
| leucine-rich repeat | 244..267 | CDD:275380 | 7/19 (37%) | ||
| LRR 9 | 267..288 | 7/22 (32%) | |||
| leucine-rich repeat | 268..291 | CDD:275380 | 7/24 (29%) | ||
| LRR 10 | 291..312 | 8/21 (38%) | |||
| leucine-rich repeat | 292..315 | CDD:275380 | 9/23 (39%) | ||
| LRR 11 | 315..337 | 8/21 (38%) | |||
| leucine-rich repeat | 316..338 | CDD:275380 | 8/21 (38%) | ||
| LRR 12 | 340..361 | 5/20 (25%) | |||
| leucine-rich repeat | 341..364 | CDD:275380 | 7/22 (32%) | ||
| LRR 13 | 364..385 | 6/20 (30%) | |||
| leucine-rich repeat | 365..388 | CDD:275380 | 6/22 (27%) | ||
| LRR 14 | 388..409 | 6/20 (30%) | |||
| leucine-rich repeat | 389..410 | CDD:275380 | 6/20 (30%) | ||
| PCC | 394..>458 | CDD:188093 | 20/66 (30%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 474..499 | 6/25 (24%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||