DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and Lrit1

DIOPT Version :10

Sequence 1:NP_609615.2 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_666357.2 Gene:Lrit1 / 239037 MGIID:2385320 Length:624 Species:Mus musculus


Alignment Length:386 Identity:86/386 - (22%)
Similarity:135/386 - (34%) Gaps:81/386 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WLLDCGNCHCKW----------------NSGKKTADCRNLSLSGVPEYLSPEVQVLDLSHNHIFY 86
            |||..|..|..|                .|..:|..|.:..|:..|..:.|:.            
Mouse     9 WLLALGGPHQAWGFCPSECSCSLRILSDGSKARTVVCSDPDLTLPPASIPPDT------------ 61

  Fly    87 LEENAFLTTHLQNLQKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSKVRAI 151
                          .||.:....::.:...:|..|..|.:|.|..|.|.:|...:...|.::|.:
Mouse    62 --------------CKLRLERTAIRRVPGETFRPLSRLEQLWLPYNALSELSALMLRGLRRLREL 112

  Fly   152 FLNGNLLQALRHGVFRNLKYLHKIELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLRVESFQD 216
            .|.||.|........|:...|..::|:.|||.::..:|...:..|:.:.|.||:|.:|..|....
Mouse   113 RLPGNRLVTFPWAALRDTPQLQLLDLQANRLSTLPPEAAHFLENLTFLDLSNNQLMRLPEELLDV 177

  Fly   217 LTKLTA------------LSLVENPWNCTC---DLQMFRDFVIGMNL--YTPPTSCHYPLQLRGR 264
            ...|..            |.|.:|||.|.|   ||....|..:..||  ......|..|..|.|.
Mouse   178 WAHLKTGPFLSGHHARLILGLQDNPWVCDCRLYDLVHLLDGWVSSNLIFIEARLRCASPRSLAGV 242

  Fly   265 LWIEDQPEAFACKPKIVYPTLSTSINTSKENVTLICRVHGSPNTVIAWDYTNQVYESRSKPVKSL 329
            .:  .|.|...|:...:.|.:::.|:.....|.|.|...|.|...::|...|      .:|:...
Mouse   243 AF--SQLELRKCQSPELRPGVTSIISPLGSTVLLRCGATGIPGPEMSWRRAN------GRPLNGT 299

  Fly   330 QKQRIYIELLREDESKIRKFGHDVFVSRLTIVNARKSDEGVYTCLAENPGGKDSVHISVVV 390
            ..|.:..:            |....:..|.:|:.  .|.|.|.|.|:|..|.....||::|
Mouse   300 VHQEVSSD------------GSSWTLLDLPVVSL--FDSGDYICQAKNFLGASETLISLIV 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_609615.2 LRR 59..>228 CDD:443914 36/180 (20%)
leucine-rich repeat 75..99 CDD:275380 0/23 (0%)
LRR_8 98..158 CDD:404697 15/59 (25%)
leucine-rich repeat 100..123 CDD:275380 4/22 (18%)
leucine-rich repeat 124..147 CDD:275380 7/22 (32%)
leucine-rich repeat 148..171 CDD:275380 6/22 (27%)
leucine-rich repeat 172..195 CDD:275380 6/22 (27%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
LRRCT 228..277 CDD:214507 16/53 (30%)
IG_like 294..390 CDD:214653 21/95 (22%)
Ig strand B 296..300 CDD:409353 2/3 (67%)
Ig strand C 309..323 CDD:409353 2/13 (15%)
Ig strand E 356..360 CDD:409353 1/3 (33%)
Ig strand F 370..375 CDD:409353 2/4 (50%)
Ig strand G 383..386 CDD:409353 0/2 (0%)
Lrit1NP_666357.2 LRRNT 23..61 CDD:214470 6/37 (16%)
LRR 1 60..81 3/46 (7%)
LRR <63..>174 CDD:443914 29/110 (26%)
leucine-rich repeat 64..84 CDD:275378 3/19 (16%)
LRR 2 84..105 6/20 (30%)
leucine-rich repeat 85..132 CDD:275378 13/46 (28%)
LRR 3 108..129 5/20 (25%)
LRR 4 132..153 6/20 (30%)
leucine-rich repeat 133..156 CDD:275378 6/22 (27%)
LRR 5 156..177 7/20 (35%)
leucine-rich repeat 157..180 CDD:275378 7/22 (32%)
leucine-rich repeat 181..205 CDD:275378 6/23 (26%)
LRRCT 201..>241 CDD:214507 13/39 (33%)
Ig 258..346 CDD:472250 23/107 (21%)
Ig strand B 272..276 CDD:409353 2/3 (67%)
Ig strand C 285..289 CDD:409353 0/3 (0%)
Ig strand E 309..313 CDD:409353 0/3 (0%)
Ig strand F 326..331 CDD:409353 2/4 (50%)
Ig strand G 339..342 CDD:409353 0/2 (0%)
FN3 432..502 CDD:214495
LRR 6 526..549
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.