DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek4 and Lingo3

DIOPT Version :9

Sequence 1:NP_001260435.1 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001013780.2 Gene:Lingo3 / 237403 MGIID:3609246 Length:589 Species:Mus musculus


Alignment Length:559 Identity:122/559 - (21%)
Similarity:184/559 - (32%) Gaps:194/559 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 CKWNSGKKTADCRNLSLSGVPEYLS------------------------PEVQVLDLSHNHIFYL 87
            |:.::..:|..|....|:.:||.:.                        |.::.|||:||.|.::
Mouse    28 CECSASTRTVACGRRRLTAIPEGIPAETRMLELSRNRIRCLNPGDLASLPTLEELDLNHNVIAHV 92

  Fly    88 EENAFLTTHLQNLQKLLIRNGTLKYLNQRSFTQLQILIELDLSNNLLVDLLPNVFDCLSKVR--- 149
            |..||  .:|..|:.|.:|...||.:....||.|..|..||||.|.||.||...|..|..::   
Mouse    93 EPGAF--ANLPRLRVLRLRGNQLKLIPPGVFTHLDSLTLLDLSENKLVILLDFSFQDLRSLQRLE 155

  Fly   150 -----AIFLN----------------------------GNL--LQALR----------------- 162
                 .:|::                            |:|  |.|||                 
Mouse   156 VGDNDLVFISRRAFAGLLGLAELTLERCNLTSLSPESLGHLRGLGALRLRHLAIAALEDQNFQKL 220

  Fly   163 ----------------------------------------------------------------- 162
                                                                             
Mouse   221 PGLSHLEIDNWPLLEEVAPGSLRGLNLTSLSITHTNITAVPAAALRQQAHLTCLNLSHNPISMVP 285

  Fly   163 HGVFRNLKYLHKIELKRNRLVSIDAKAFVGVPLLSQIYLDNNELTKLRVESFQDLTKLTALSLVE 227
            .|.||:|..|.::.|....|..|:.:||||:..:..:.|.:|.|:.|...:|..:..|..|.:..
Mouse   286 RGSFRDLVRLRELHLAGALLAVIEPQAFVGLRQIRLLNLSDNLLSTLEENTFHSVNTLETLRVDG 350

  Fly   228 NPWNCTCDLQMFRDFVIGMNLYTPPTSCHYPLQLRGRLWIEDQP-----EAFAC-KPKIVYPTLS 286
            ||..|.|.|.........:|......:|..|.::||.. :.:.|     |.|.| ||||....|.
Mouse   351 NPLACDCRLLWIVQRRKTLNFDGRLPACATPAEVRGDA-LHNLPDSVLFEYFVCRKPKIRERRLQ 414

  Fly   287 TSINTSKENVTLICRVHGSPNTVIAWDYTNQVYESRSKPVKSLQKQRIYIELLREDESKIRKFGH 351
            ....|..::|..:||..|.|...:||                :..|...:.......:::...| 
Mouse   415 HVTATEGDDVRFLCRAEGEPAPTVAW----------------VTPQHHSVTAASRGRARVLPGG- 462

  Fly   352 DVFVSRLTIVNARKSDEGVYTCLAENPGGKDSVHISVVVQKDMERISLIDSN-----------FF 405
                 .|||.:.|..|.|.|||:|.|.||.|:...::.||....|......|           ..
Mouse   463 -----TLTIADTRPQDSGTYTCVASNAGGNDTYFATLTVQPAANRTQGDGHNETQVGVRFPLDLT 522

  Fly   406 AIVCLIAMG---FLSMSILFSLVTCLIFKRFKQFHPGQH 441
            .|:...|||   ||.: :||..:...::.|.:    |||
Mouse   523 TILVSTAMGCITFLGV-VLFCFLLLFVWSRGR----GQH 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek4NP_001260435.1 leucine-rich repeat 75..99 CDD:275380 10/23 (43%)
LRR_8 99..158 CDD:290566 23/96 (24%)
leucine-rich repeat 100..123 CDD:275380 8/22 (36%)
leucine-rich repeat 124..147 CDD:275380 12/22 (55%)
LRR_8 146..206 CDD:290566 21/179 (12%)
leucine-rich repeat 148..171 CDD:275380 11/142 (8%)
leucine-rich repeat 172..195 CDD:275380 8/22 (36%)
leucine-rich repeat 196..219 CDD:275380 5/22 (23%)
TPKR_C2 228..277 CDD:301599 14/54 (26%)
IG_like 294..390 CDD:214653 23/95 (24%)
Ig 296..387 CDD:143165 23/90 (26%)
Lingo3NP_001013780.2 LRRNT 23..55 CDD:214470 6/26 (23%)
leucine-rich repeat 34..53 CDD:275380 5/18 (28%)
LRR 1 54..75 0/20 (0%)
LRR <55..353 CDD:227223 58/299 (19%)
leucine-rich repeat 55..78 CDD:275380 0/22 (0%)
LRR 2 78..99 9/22 (41%)
leucine-rich repeat 79..102 CDD:275380 10/24 (42%)
LRR 3 102..123 6/20 (30%)
leucine-rich repeat 103..150 CDD:275380 20/46 (43%)
LRR 4 126..147 11/20 (55%)
LRR 5 150..171 1/20 (5%)
leucine-rich repeat 151..174 CDD:275380 1/22 (5%)
LRR 6 174..195 0/20 (0%)
leucine-rich repeat 175..198 CDD:275380 2/22 (9%)
leucine-rich repeat 199..222 CDD:275380 4/22 (18%)
LRR 7 206..227 0/20 (0%)
leucine-rich repeat 223..246 CDD:275380 0/22 (0%)
LRR_8 246..302 CDD:338972 6/55 (11%)
LRR 8 246..267 0/20 (0%)
leucine-rich repeat 247..270 CDD:275380 0/22 (0%)
LRR 9 270..291 2/20 (10%)
leucine-rich repeat 271..292 CDD:275380 3/20 (15%)
LRR 10 294..315 6/20 (30%)
leucine-rich repeat 295..318 CDD:275380 8/22 (36%)
LRR 11 318..339 5/20 (25%)
leucine-rich repeat 321..342 CDD:275380 5/20 (25%)
PCC 331..>405 CDD:188093 18/74 (24%)
I-set 406..496 CDD:369462 28/111 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8825
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.